pe
pep-10970 v1 CC-BY-SA-4.0

Cotadutide: experimental weight-loss & liver-disease drug (MEDI0382)

An experimental once-daily injectable developed by AstraZeneca that targets two gut hormones to lower blood sugar, reduce weight, and treat fatty liver disease; not yet an approved drug.

statuscomputed targetGCGR length31 aa refs3
status 2 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.858
pTM0.749
avg pLDDT54.0
ranking score0.907
STRUCTURE · PEP-10970 × GCGR
ranking0.907
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence31 aa
15101520253031
HSQGTFTSDYSKYLDS ERAAKEFIAWLVKGR
in the news 220 articles
overview readme

What this is

Cotadutide (development code MEDI0382) is an experimental once-daily injectable peptide that activates two related gut-hormone receptors at the same time: the GLP-1 receptor — the same target as Ozempic and Victoza — and the glucagon receptor. It was developed by MedImmune/AstraZeneca for type 2 diabetes, obesity, fatty liver disease (NASH/MASH), and diabetic kidney disease. The stored 31-residue chimeric sequence is the bare peptide backbone built from key residues of both glucagon and GLP-1; the active drug additionally carries a C16 palmitic-acid chain tethered to an internal lysine via a γ-glutamate spacer, which lets it bind albumin and circulate long enough for once-daily dosing (Henderson and colleagues, Diabetes, Obesity and Metabolism, 2016). AstraZeneca terminated the cotadutide program in April 2023 in favour of a once-weekly successor, so cotadutide reached Phase 2b but never Phase 3 and is not approved.

History

Cotadutide came out of a structure-based engineering program at MedImmune aimed at combining glucagon's hepatic lipid-burning activity with GLP-1's glucose-lowering safety in a single molecule. The molecule was designed with a roughly five-fold bias toward the GLP-1 receptor over the glucagon receptor, intended to keep the glucagon arm's hepatic benefit without provoking clinically significant hyperglycaemia (Henderson and colleagues, 2016). First-in-human Phase 1/2a data in patients with type 2 diabetes were published by Ambery and colleagues in The Lancet in 2018, showing reductions in post-meal glucose and body weight versus placebo over 41 days. Cotadutide then became the first GLP-1/glucagon dual agonist to generate meaningful Phase 2b data in metabolic-disease populations (Nahra and colleagues, Diabetes Care, 2021). In April 2023, AstraZeneca announced it was stopping cotadutide development to focus instead on a once-weekly GLP-1/glucagon dual-agonist successor, citing the shift in the diabetes and obesity market toward weekly dosing rather than any safety concern.

What it does

Cotadutide simultaneously turns on two receptors that sit at the centre of energy and liver metabolism. Through the GLP-1 receptor it lowers blood glucose by stimulating glucose-dependent insulin secretion, slows gastric emptying, and suppresses appetite. Through the glucagon receptor it acts on the liver to increase fat oxidation and reduce hepatic lipid accumulation. In clinical trials this translated into lower HbA1c, weight loss, and reductions in liver fat and liver enzymes (ALT/AST) in adults with type 2 diabetes and overweight or obesity (Nahra and colleagues, Diabetes Care, 2021). The 5:1 GLP-1:glucagon-receptor bias was selected so the GLP-1 arm's insulin-secretion effect counterbalances any glucagon-driven rise in hepatic glucose output (Henderson and colleagues, 2016; Boland and colleagues, Nature Metabolism, 2020).

Evidence

Human. The Phase 2b trial by Nahra and colleagues (Diabetes Care, 2021) randomised 834 adults with type 2 diabetes inadequately controlled on metformin to cotadutide 100 µg, 200 µg, or 300 µg once daily, placebo, or open-label liraglutide 1.8 mg for 54 weeks. Cotadutide significantly reduced HbA1c and body weight versus placebo at week 14 and week 54 (all P < 0.001); ad-hoc analyses also showed improvements in hepatic parameters. A mechanistic Phase 2a study (Parker and colleagues, Nature Metabolism, 2023) directly compared cotadutide with liraglutide in people with type 2 diabetes and obesity and reported that cotadutide reduced fasting hepatic glycogen and produced about 12.5% greater postprandial glucose reduction than liraglutide — evidence that the glucagon arm contributed real, GLP-1-distinct hepatic effects. In diabetic kidney disease, Selvarajah and colleagues (Kidney International, 2024) reported that 300 µg and 600 µg once-daily cotadutide reduced urinary albumin-to-creatinine ratio by roughly 44% and 50% versus placebo on top of standard care.

Animal. Boland and colleagues (Nature Metabolism, 2020) showed that cotadutide resolved NASH and hepatic fibrosis in two mouse models, with the liver-specific benefits — reduced hepatic lipid content, improved mitochondrial function, normalised glycogen flux — attributable to the glucagon-receptor arm rather than to GLP-1 signalling alone. Henderson and colleagues (2016) had earlier shown anti-obesity and metabolic effects in diet-induced obese mice and cynomolgus monkeys, with weight loss exceeding that of liraglutide at comparable doses.

Background. Cotadutide sits within the broader pharmacology of proglucagon-derived peptides, reviewed by Lafferty and colleagues (Frontiers in Endocrinology, 2021).

Known effects

  • Glycaemic control (HbA1c reduction) — Phase 2b in type 2 diabetes (Nahra 2021)
  • Body weight reduction — Phase 2b (Nahra 2021)
  • Hepatic fat and liver-enzyme reduction — Phase 2b ad-hoc analyses (Nahra 2021)
  • Hepatic glycogen modulation and superior postprandial glucose reduction vs liraglutide — mechanistic Phase 2a (Parker 2023)
  • Urinary albumin reduction in diabetic kidney disease — Phase 2b (Selvarajah 2024)
  • NASH histological improvement and fibrosis reversal — preclinical (Boland 2020)
  • Anti-obesity and metabolic effects in non-human primates — preclinical (Henderson 2016)

Safety signals

Gastrointestinal adverse events — nausea and vomiting — were the dominant tolerability signal in cotadutide trials, consistent with the GLP-1 receptor agonist class. In the Phase 2b diabetic kidney disease trial, treatment-discontinuation rates from adverse events reached approximately 21% at the highest 600 µg dose, with most events gastrointestinal (Selvarajah and colleagues, Kidney International, 2024). Glucagon co-activation did not produce clinically significant hyperglycaemia at the 5:1 GLP-1:glucagon-receptor bias used (Henderson and colleagues, 2016; Nahra and colleagues, 2021). The palmitoyl-γ-glutamate albumin-binding modification — chemically analogous to the design used in liraglutide — was generally well tolerated.

Regulatory status

  • US/EU: Not approved. Development was active through Phase 2b across type 2 diabetes, NASH/MASH, and diabetic kidney disease.
  • Program status: AstraZeneca announced termination of the cotadutide program in April 2023, redirecting effort to a once-weekly GLP-1/glucagon dual-agonist successor. No Phase 3 trial was initiated.

Mechanism

Cotadutide is a 31-residue chimeric peptide whose sequence draws structural elements from both glucagon and GLP-1, with a γ-glutamate-linked C16 palmitic acid attached to an internal lysine for reversible albumin binding and once-daily pharmacokinetics (Henderson and colleagues, Diabetes, Obesity and Metabolism, 2016). The peptide engages the GLP-1 receptor and the glucagon receptor — both Gαs-coupled — with a roughly 5:1 potency bias toward GLP-1R. At pancreatic β-cells the GLP-1R arm drives glucose-dependent insulin secretion; at hypothalamic appetite circuits it suppresses food intake; at the stomach it delays gastric emptying. The glucagon-receptor arm acts predominantly on hepatocytes, where it increases fatty-acid oxidation, reduces de novo lipogenesis, and modulates glycogen turnover. Boland and colleagues (Nature Metabolism, 2020) used receptor-specific dissection in mouse models to show that cotadutide's hepatic lipid-lowering and mitochondrial-function effects depend on the glucagon-receptor arm and are not reproduced by GLP-1R activation alone, while body-weight and food-intake effects are predominantly GLP-1R-mediated. Parker and colleagues (Nature Metabolism, 2023) demonstrated in humans that cotadutide reduces fasting hepatic glycogen and produces greater postprandial glucose reduction than liraglutide at comparable GLP-1R-mediated weight loss — direct human-pharmacology evidence that the glucagon arm contributes biology beyond GLP-1 monoagonism.

Open questions

  • Whether cotadutide's 5:1 GLP-1:glucagon-receptor bias is the right balance for hepatic-fibrosis resolution, or whether a more glucagon-weighted ratio provides deeper liver benefit.
  • Whether AstraZeneca's 2023 termination reflected the competitive shift to weekly dosing and the GLP-1 monoagonist explosion, or whether internal Phase 2b readouts on registration-grade liver-fibrosis endpoints fell short.
  • Whether the kidney-protective albumin-reduction signal seen in the diabetic kidney disease Phase 2b (Selvarajah 2024) translates to the once-weekly successor dual-agonist program.

Related peptides

  • Liraglutide — single-target GLP-1 receptor agonist using the same palmitoyl-γ-Glu-Lys albumin-binding chemistry; cotadutide's direct GLP-1-only comparator in the Phase 2b trial (Nahra 2021).
  • Semaglutide — once-weekly GLP-1 receptor agonist; the dominant GLP-1 monoagonist whose commercial success contributed to AstraZeneca's strategic deprioritisation of cotadutide.
  • Tirzepatide — once-weekly GLP-1/GIP dual agonist; a different dual-agonist pairing that achieved Phase 3 success in diabetes and obesity while cotadutide did not.
  • Survodutide, pemvidutide, mazdutide — competing GLP-1/glucagon dual agonists with different receptor-bias ratios, still in active clinical development as of 2024.
Hypotheses4 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does cotadutide's glucagon-activating component fix liver damage through a separate biological route, on top of what weight loss achieves?

If so, patients with fatty liver disease could benefit from drugs like cotadutide even if they lose only modest weight, offering a new treatment path for a condition that has very limited options today.

The hypothesis
Cotadutide's simultaneous GCGR activation produces hepatic lipid oxidation that is mechanistically additive with, rather than redundant to, GLP-1R-driven reductions in hepatic lipogenesis, making the dual-agonist strategy genuinely superior to GLP-1R monotherapy for MASH fibrosis reversal even at matched body-weight loss.
Why it’s plausible
Phase 2 data showed cotadutide reduced liver fat more than liraglutide at comparable glycaemic control (doi:10.1038/s42255-023-00938-0). GCGR signalling in hepatocytes activates PKA/HSL-driven fatty acid oxidation via a pathway distinct from the GLP-1R's predominant effect on reducing de novo lipogenesis and nutrient intake. If these are non-overlapping, MASH histological endpoints (ballooning, fibrosis stage) should improve disproportionately relative to weight loss alone.
Why it matters
If verified, this would justify dual GLP-1R/GCGR agonism as the mechanistically preferred approach specifically for MASH fibrosis, independent of weight loss, and would resurrect the cotadutide pharmacophore in AstraZeneca's successor molecule for liver-specific indications.
Plausibility.75
Novelty.50
Impact.80
Basis · grounding3 papers
[1]
paper
Cotadutide vs liraglutide trial shows greater liver fat reduction with dual agonism than GLP-1R monotherapy
doi: 10.1038/s42255-023-00938-0
[2]
paper
Review discusses optimal cotargeting requiring understanding of related but distinct physiologic processes
doi: 10.1152/physrev.00057.2024
[3]
paper
MEDI0382 pharmacology paper characterises the combined receptor mechanism
doi: 10.1111/dom.12735
openupdated 2026-06-05

Do a handful of specific residues in cotadutide determine whether the drug leans more toward the GLP-1 side or the glucagon side, and could disease change that balance?

If true, drug designers could fine-tune future weight-loss and liver medicines to be safer in people whose livers have unusually high glucagon sensitivity, reducing the risk of blood-sugar spikes.

The hypothesis
The five-fold GLP-1R bias built into cotadutide's chimeric sequence is structurally encoded primarily by residues 7-13 (TSDYSKY), which recapitulate the GLP-1 receptor-contacting face, and loss of this bias under conditions of high hepatic glucagon receptor density could unmask glycaemic risk that was not apparent in the Phase 2b population.
Why it’s plausible
The ipTM of 0.86 indicates a confident dual-receptor complex prediction, yet pLDDT of 54 suggests the backbone is largely disordered in isolation, consistent with an intrinsically disordered peptide that only folds on receptor engagement. The five-fold GLP-1R preference was an explicit design target (Henderson et al., 2016). Residues 7-13 of the sequence HSQGTFTSDYSKYLDSERAAKEFIAWLVKGR correspond to the discriminating GLP-1-like segment; any receptor-expression imbalance in metabolically diseased liver could shift the effective potency ratio toward GCGR engagement.
Why it matters
Understanding which sequence positions encode receptor-selectivity ratio would allow redesign of next-generation dual agonists that maintain hepatic GCGR benefit without hyperglycaemia liability, directly informing AstraZeneca's successor program.
Plausibility.70
Novelty.50
Impact.60
Basis · grounding2 papers · 1 computed/note
[1]
paper
Henderson et al. characterise MEDI0382 pharmacology and state the five-fold GLP-1R bias as an intentional design feature
doi: 10.1111/dom.12735
[2]
paper
Review notes that optimal dosing of cotargeting compounds is challenging because related physiologic processes interact
doi: 10.1152/physrev.00057.2024
[3]
structureipTM=0.86 supports genuine dual-receptor docking; pLDDT=54 consistent with disorder-to-order folding on binding
openupdated 2026-06-05

Could a drug abandoned for diabetes still be useful for preventing the liver cancers that fatty liver disease can cause?

Fatty liver disease is now one of the leading causes of liver cancer worldwide, and there are almost no preventive drugs. If cotadutide-type medicines could interrupt that progression, millions of patients with chronic liver disease might have a new protective option.

The hypothesis
Cotadutide's dual GLP-1R/GCGR agonism could attenuate non-alcoholic steatohepatitis-driven hepatocellular carcinoma progression because GCGR signalling suppresses hepatocyte glucose output while GLP-1R activation reduces inflammatory cytokine burden, and tumour hepatocytes retain functional GCGR expression at early HCC stages.
Why it’s plausible
MASH is a major driver of HCC. GLP-1R agonists have emerging data on anti-tumour immune effects. GCGR is expressed in differentiated hepatocytes and early HCC cells retain this expression. Cotadutide's combined receptor engagement could interrupt the metabolic-inflammatory axis that drives MASH-to-HCC progression, a hypothesis untested in the Phase 2b program which excluded patients with advanced liver disease.
Why it matters
MASH-associated HCC has limited treatment options. If cotadutide-class molecules can be repositioned for chemoprevention in high-risk MASH patients, they address an unmet oncological need entirely outside the original metabolic disease indication.
Plausibility.55
Novelty.60
Impact.70
Basis · grounding3 papers
[1]
paper
Clinical evidence of liver fat reduction and metabolic improvement in MASH-relevant patients
doi: 10.1038/s42255-023-00938-0
[2]
paper
Hepatic GCGR engagement is a core pharmacological property of MEDI0382
doi: 10.1111/dom.12735
[3]
paper
Review discusses cotargeting in metabolic liver disease, noting hepatic inflammation as a shared endpoint
doi: 10.1152/physrev.00057.2024
openupdated 2026-06-05

Could engineers modify cotadutide to also repair the gut lining, which often drives the liver damage that cotadutide targets?

Many patients with fatty liver disease also have a leaky gut that feeds inflammation into the liver. A drug addressing both problems at once could work better than current medicines and might be needed in smaller doses, potentially reducing side effects.

The hypothesis
Replacing the palmitic acid C16 albumin-binding tag of cotadutide with a GLP-2R-targeting peptide fragment would create a triple agonist (GLP-1R/GCGR/GLP-2R) that combines hepatic lipid-burning with intestinal barrier repair, selectively benefiting patients with concurrent MASH and increased intestinal permeability.
Why it’s plausible
Cotadutide's C16 fatty acid chain is a half-life extender, not a pharmacophore. GLP-2R agonism (as exploited by teduglutide for short bowel syndrome) promotes intestinal mucosal integrity and reduces bacterial translocation, which is a mechanistic driver of MASH. The structural precedent for a chimeric dual/triple gut-hormone peptide already exists in cotadutide itself. GLP-1, glucagon, and GLP-2 are all processed from proglucagon, so their receptor-binding domains are structurally compatible for hybridisation.
Why it matters
Intestinal leakiness drives MASH progression via portal LPS load. A molecule that simultaneously reduces hepatic lipid accumulation and repairs the gut-liver axis could offer superior MASH efficacy to any current single or dual agonist, with a mechanistic basis entirely distinct from weight-loss-driven improvement.
Plausibility.45
Novelty.75
Impact.70
Basis · grounding2 papers · 1 computed/note
[1]
paper
Teduglutide (GLP-2R agonist) approval context shows intestinal repair is a pharmacologically tractable target in the same proglucagon family
doi: 10.1016/j.clnu.2013.03.016
[2]
paper
MEDI0382 is a chimeric glucagon/GLP-1 peptide, demonstrating the feasibility of combining proglucagon-derived receptor pharmacophores
doi: 10.1111/dom.12735
[3]
sequenceCotadutide sequence HSQGTFTSDYSKYLDSERAAKEFIAWLVKGR is itself a designed chimera, establishing the engineering precedent for further hybridisation
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8578919172286987 openfold3-mlx
ranking score 0.9070388674736023 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.687global PDE — lower = better
disorder0.142fraction disordered
chain pair ipTM (A, B)0.858interface quality
3-letter notation
His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Glu-Arg-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weights
hardware
mlx version
python
random seed
msa strategy
diffusion samples1
runtime623s
predicted bymlx@peptide
predicted at2026-04-30
citationbibtex
peptidemodel (2026). Cotadutide: experimental weight-loss & liver-disease drug (MEDI0382) (pep-10970, v1). PeptideModel. https://peptidemodel.com/card/pep-10970
@peptide{pep10970,
  sequence = {HSQGTFTSDYSKYLDSERAAKEFIAWLVKGR},
  target   = {gcgr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {computed}
}
related peptides 2 by signal overlap
clinical trials 23 on ct.gov · 3 on EUCTR · checked 2026-05-22
ct.gov trials 23
with results 12
EUCTR 3
PubMed RCT 10
by phase
4phase 16phase 2
by status
9completed1terminated
references 3 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use