Exenatide — Byetta/Bydureon, first-approved GLP-1 receptor agonist
39-aa GLP-1R agonist derived from Gila monster exendin-4; FDA-approved T2DM treatment; twice-daily (Byetta) or weekly XR (Bydureon); first-in-class GLP-1 agonist (2005); sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
- Class
- GLP-1 receptor agonist (venom-derived synthetic peptide)
- Status
- FDA-approved prescription drug (Byetta 2005; Bydureon / Bydureon BCise 2012 / 2017); EMA, MHRA, Health Canada, TGA authorized
- Best-supported effect
- HbA1c reduction 0.8–1.9 percentage points and modest weight loss (~3–5 kg) in adults with type 2 diabetes, across Phase III trials and 15+ years of post-marketing data (human — approved label)
- Main caveat
- No FDA weight-management indication; EXSCEL cardiovascular outcomes trial neutral for MACE superiority (unlike liraglutide, semaglutide, dulaglutide); largely displaced by semaglutide, tirzepatide, and dulaglutide in current new-start clinical practice
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Snapshot
Class: GLP-1 receptor agonist (venom-derived synthetic peptide)
Evidence tier: Approved drug
Status: FDA-approved prescription drug (Byetta 2005; Bydureon / Bydureon BCise 2012 / 2017); authorized by EMA, UK MHRA, Health Canada, and Australia's TGA
Best-supported effect: Glycemic control (HbA1c reduction 0.8–1.9 percentage points) and modest weight reduction (~3–5 kg) in adults with type 2 diabetes, across extensive Phase III trials and more than 15 years of post-marketing data
Main caveat: No FDA weight-management indication; cardiovascular outcomes trial (EXSCEL) was neutral for MACE superiority, distinguishing exenatide from other GLP-1 agonists with positive CV signals; largely displaced in new-start practice by semaglutide, tirzepatide, and dulaglutide
What this is
Exenatide is a synthetic 39-amino-acid peptide modeled on exendin-4, a compound isolated from the salivary glands of the Gila monster (Heloderma suspectum), a venomous lizard native to the southwestern United States and northern Mexico. It shares approximately 53% sequence homology with human GLP-1 but carries a glycine residue at position 2 instead of alanine, which confers resistance to cleavage by dipeptidyl peptidase-4 (DPP-4) — the enzyme that degrades native GLP-1 within minutes. This structural difference was the key discovery by endocrinologist John Eng in the early 1990s and underpins the entire GLP-1 drug class. Exenatide is not extracted from lizards; it is manufactured by solid-phase peptide synthesis.
Exenatide was the first GLP-1 receptor agonist approved for clinical use. It is available in two distinct formulations: Byetta (short-acting, twice-daily subcutaneous injection) and Bydureon / Bydureon BCise (extended-release weekly microsphere formulation). As the first-in-class agent, it established proof of concept for GLP-1 receptor agonism in type 2 diabetes but has since been largely superseded by agents with greater HbA1c and weight-loss efficacy and stronger cardiovascular outcomes data. Its ongoing clinical role is primarily in patients already established on therapy or those with cost, insurance, or tolerability considerations.
Evidence map
| Evidence layer | Grade | What it supports |
|---|---|---|
| Human | Approved — extensive | HbA1c reduction 0.8–1.9 percentage points; modest weight loss (~3–5 kg); glycemic control in T2D across multiple Phase III trials (DURATION series and others) and 15+ years of post-marketing surveillance; EXSCEL cardiovascular outcomes trial (n=14,752) showed non-inferiority but not MACE superiority |
| Animal | Strong | Exendin-4 biology and GLP-1R pharmacology are comprehensively characterized in animal models; rodent C-cell tumor findings underpin the class boxed warning |
| In vitro | Strong | GLP-1 receptor binding, cAMP/PKA signaling pathway, DPP-4 resistance mechanism, and microsphere release pharmacology are well-characterized |
| Computational | None identified | No computational prediction data attached |
| Mechanism | Strong | GLP-1R agonism with downstream cAMP/PKA signaling is verified; DPP-4 resistance mechanism is established at the structural level |
Claim check
| Claim | Verdict | Evidence layer | Confidence |
|---|---|---|---|
| Reduces HbA1c and improves glycemic control in adults with type 2 diabetes | Supported | Human — Phase III trials and FDA label | High |
| Reduces body weight in T2D patients | Supported — modest effect (~3–5 kg typical) | Human — Phase III trials and FDA label | High |
| Provides cardiovascular event superiority (MACE reduction) | Not established — EXSCEL neutral for superiority | Human — EXSCEL outcomes trial (n=14,752) | High — trial completed; superiority not demonstrated |
| Equivalent to semaglutide or tirzepatide for weight loss | Contradicted / not supported | Human — head-to-head and network meta-analyses | High |
| Equivalent to semaglutide or tirzepatide for cardiovascular outcomes | Not established | Human — CV outcomes trials differ across GLP-1 class | High |
| Approved for weight management as a primary indication | Contradicted / not approved | Human — FDA label (diabetes indication only) | High |
| Safe for type 1 diabetes use | Not applicable / not approved | Human — label exclusion | High |
| Pediatric type 2 diabetes use (Bydureon BCise, age 10+) | Supported — narrower evidence base than adults | Human — pediatric indication labeling | Medium — long-term pediatric data thinner than adult data |
Exposure studied
This section reports exposure used in FDA-labeled and trial-studied contexts. It is not a personalized protocol.
| Context | Population | Exposure studied | Duration | Endpoint | Limitation |
|---|---|---|---|---|---|
| FDA label — Byetta | Adults with type 2 diabetes | 5 mcg SC twice daily (first month), escalating to 10 mcg twice daily; administered within 60 minutes before morning and evening meals | Chronic / ongoing; not cycled | HbA1c reduction; glycemic control | Short half-life (~2.4 h) requires meal-timed dosing; not recommended with eGFR <30 mL/min/1.73m² |
| FDA label — Bydureon / BCise | Adults with type 2 diabetes | 2 mg SC once weekly; fixed dose, no titration; microsphere suspension or autoinjector | Chronic / ongoing; steady state reached at approximately 6–7 weeks | HbA1c reduction; glycemic control | Injection-site nodules characteristic; microsphere depot continues releasing drug ~10 weeks after last injection; not recommended with severe renal impairment |
| Phase III trials — DURATION series | Adults with type 2 diabetes | Trial regimens for once-weekly extended-release exenatide | Up to 6 years (DURATION-1 open-label extension) | HbA1c; body weight; tolerability | Open-label extension; see |
| EXSCEL cardiovascular outcomes trial | Adults with type 2 diabetes; broad CV risk profile | Once-weekly extended-release exenatide vs. placebo added to usual care | Median 3.2 years | MACE (cardiovascular death, nonfatal MI, nonfatal stroke); all-cause mortality; heart-failure hospitalization | Neutral for MACE superiority; non-inferiority met; see |
| Pediatric label — Bydureon BCise | Patients aged 10 years and older with type 2 diabetes | 2 mg SC once weekly | Pediatric indication; long-term data limited | HbA1c reduction | Long-term efficacy and safety data in pediatric T2D thinner than in adults |
Safety signals
| Signal | Frequency / context | Notes |
|---|---|---|
| Nausea | Common, especially at initiation | Most frequent GI adverse event; generally dose-dependent and attenuates over time |
| Vomiting | Common | GI effect consistent with GLP-1 class |
| Diarrhea | Common | GI effect consistent with GLP-1 class |
| Injection-site nodules | Characteristic of Bydureon formulation | Consequence of microsphere depot; generally non-serious but persistent |
| Thyroid C-cell tumor | Boxed warning | Class risk based on rodent C-cell findings; human relevance debated; absolute contraindication in personal or family history of medullary thyroid carcinoma (MTC) or MEN2 |
| Acute pancreatitis | Post-marketing signal | Rare; label caution; absolute contraindication in history of severe or recurrent pancreatitis |
| Hypoglycemia | Risk elevated when co-administered with insulin or sulfonylureas | Not intrinsic to monotherapy; dose reduction of concomitant secretagogue or insulin required when adding exenatide |
| Renal impairment / acute kidney injury | Post-marketing signal | Exenatide is renally cleared; not recommended with eGFR <30 mL/min/1.73m²; acute kidney injury signals in post-marketing context |
| Delayed gastric emptying effects on co-medications | Interaction signal from label | Clinically relevant for narrow-therapeutic-index oral drugs; INR monitoring advised with warfarin; oral contraceptives and oral antibiotics timing affected |
| Delayed gastric emptying worsening | Caution in gastroparesis | GLP-1 agonism slows gastric emptying; significant GI motility disorders are a labeled caution |
| Long-term microsphere depot tissue effects | Not established | Injection-site nodule consequences of repeated microsphere deposition over years not rigorously characterized |
| Pregnancy and breastfeeding | Labeled caution | Animal reproductive toxicity; absence of human safety data; Bydureon depot means ~10-week washout is relevant pre-pregnancy planning |
| Long-term cardiovascular outcomes | Neutral MACE trial | EXSCEL showed non-inferiority (not harm) for MACE; directional signals on all-cause mortality and heart-failure hospitalization trended favorably; superiority not reached |
Label safety exclusions (absolute contraindications per labeling): Personal or family history of medullary thyroid carcinoma (MTC); Multiple Endocrine Neoplasia syndrome type 2 (MEN2); severe renal impairment (eGFR <30 mL/min/1.73m²) or end-stage renal disease; history of severe or recurrent pancreatitis; type 1 diabetes; severe gastroparesis; prior serious hypersensitivity reaction to exenatide or formulation components.
Regulatory status
| Region / body | Status | Notes |
|---|---|---|
| US (FDA) | Approved prescription drug | Byetta approved April 2005; Bydureon approved 2012; Bydureon BCise 2017; indication: type 2 diabetes in adults (Byetta) and adults and patients aged ≥10 (Bydureon BCise); no weight-management indication |
| EU (EMA) | Authorized | Authorized for type 2 diabetes; per available sources authorization; current authorization status not independently refreshed in this card |
| UK (MHRA) | Authorized | per available sources authorization for type 2 diabetes |
| Canada (Health Canada) | Authorized | per available sources authorization for type 2 diabetes |
| Australia (TGA) | Authorized | per available sources authorization; one of the first incretin-class drugs approved globally |
| WADA | Not specifically named | GLP-1 agonists are being monitored in weight-category sports; Per available sources, exenatide is not specifically named on the WADA Prohibited List; current list status not independently verified in this card |
| Compounding (US) | Narrowed pathway | Generic exenatide commercially available since early 2020s following patent expiration; compounding pathway has narrowed; subject to same post-shortage GLP-1 compounding restrictions; status not modeled in detail in this card |
Clinical trials
| Trial / source | Phase | Population | Endpoint | Status / result |
|---|---|---|---|---|
| DURATION-1 (Bydureon once-weekly pivotal program; uncontrolled open-label extension to 6 years) | Phase III | Adults with T2D | HbA1c; tolerability | Completed; 6-year extension published |
| EXSCEL (cardiovascular outcomes trial;) | Phase III / outcomes | Adults with T2D; broad CV risk profile | MACE (CV death, nonfatal MI, nonfatal stroke); all-cause mortality; heart-failure hospitalization | Completed; neutral for MACE superiority; non-inferiority met; n=14,752 |
Additional controlled trials, network meta-analyses, and systematic reviews are cited in the available literature. Individual trial rows for the full DURATION series were not separately extracted in this card; see References for PMIDs including (DURATION-1 extension), (EXSCEL substudy), and systematic reviews across the exenatide trial program.
Last checked: 2026-05-07 (available literature date: March 1, 2026)
Mechanism
Exenatide is a full agonist at the GLP-1 receptor (GLP-1R), a class B G protein-coupled receptor expressed primarily on pancreatic beta cells, gut L-cells, and select neurons. Structural resistance to DPP-4 cleavage — conferred by glycine at position 2 of the peptide rather than the alanine present in native human GLP-1 — extends the half-life from approximately 2 minutes (native GLP-1) to approximately 2.4 hours for Byetta, and enables the Bydureon microsphere depot formulation to sustain therapeutic concentrations over 7 days.
Upon GLP-1R binding, exenatide activates adenylyl cyclase via Gs proteins, raising intracellular cAMP and activating protein kinase A (PKA). In pancreatic beta cells, this potentiates glucose-dependent insulin secretion and suppresses glucagon release — glucose-dependence is a key feature, as GLP-1R agonism does not stimulate insulin secretion in the absence of elevated glucose, limiting hypoglycemia risk in monotherapy. Additional downstream effects include delayed gastric emptying, which reduces postprandial glucose excursions, and central satiety signaling, which contributes to the observed weight reduction.
The Bydureon formulation uses poly(D,L-lactide-co-glycolide) microspheres for sustained release, achieving steady-state plasma concentrations after approximately 6–7 weeks of weekly dosing and maintaining drug release for approximately 10 weeks after the final injection.
Exenatide and native human GLP-1 share 53% sequence homology. Semaglutide, by contrast, shares 94% homology with human GLP-1 and uses a fatty-acid modification for albumin binding rather than DPP-4-resistance engineering — a mechanistic distinction that contributes to semaglutide's substantially longer half-life (~1 week) and greater receptor engagement efficiency.
Chemistry
| Field | Value |
|---|---|
| Origin | Synthetic analog of exendin-4, isolated from Heloderma suspectum (Gila monster) salivary peptides |
| Length | 39 amino acids |
| Topology | Linear |
| Homology to human GLP-1 | 53% |
| Key structural modification | Glycine at position 2 (vs. alanine in human GLP-1) — confers DPP-4 resistance |
| Half-life | ~2.4 hours (Byetta); sustained-release profile via microsphere depot (Bydureon) |
| Bydureon excipient | Poly(D,L-lactide-co-glycolide) (PLG) microspheres |
| Sequence confidence | Not individually verified against primary chemistry source in this card; available literature does not provide the full amino-acid sequence |
| Manufacture | Solid-phase peptide synthesis; not extracted from lizard tissue |
Open questions
- Mechanism behind the neutral EXSCEL cardiovascular result: Whether trial design, patient selection, adherence patterns, or exenatide's distinct pharmacology relative to other GLP-1 agonists explains the absence of MACE superiority — as seen with liraglutide (LEADER), semaglutide (SUSTAIN-6, SELECT), and dulaglutide (REWIND) — remains unresolved. Understanding this distinction could illuminate class-level vs. molecule-specific cardiovascular mechanisms.
- Long-term tissue consequences of microsphere depot: Injection-site nodules are characteristic and common with Bydureon. Rigorous long-term characterization of repeated microsphere deposition and any associated subcutaneous tissue changes over years of continuous therapy has not been published, per the available literature.
- Direct head-to-head comparisons at equipotent doses: Most comparative data on exenatide vs. semaglutide, tirzepatide, and dulaglutide come from network meta-analyses rather than directly randomized head-to-head trials at clinically matched exposures. The comparative efficacy picture at equipotent doses is less precisely characterized than meta-analyses suggest.
- Pediatric long-term efficacy and safety: Bydureon BCise carries a pediatric indication (age 10+), but the evidence base for long-term efficacy and safety in pediatric type 2 diabetes is substantially thinner than the adult evidence base. This gap is particularly important as pediatric T2D prevalence rises.
- Optimal current patient population: With semaglutide, tirzepatide, and dulaglutide dominating new starts due to superior HbA1c, weight, and cardiovascular outcomes, the patient populations for whom exenatide remains the preferred choice — beyond cost, access, or tolerability constraints — are not well-characterized by prospective data.
- Cognitive effects of GLP-1 agonists including exenatide: available literature includes meta-analyses exploring GLP-1 agonist effects on cognition in Alzheimer's disease and mild cognitive impairment and in Parkinson's disease. Exenatide-specific cognitive evidence is not separately extracted in this card; these remain class-level exploratory signals.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.8553479909896851 | boltz-2 |
| ranking score | 0.7506198287010193 | boltz-2 |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 1.042 | global PDE — lower = better |
| disorder | NaN | fraction disordered |
▸3-letter notation
▸recipeboltz-2 1.0
| parameter | value |
|---|---|
| model | boltz-2 1.0 |
| weights | — |
| hardware | nvidia_nim_api |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | none |
| diffusion samples | 1 |
| runtime | — |
| predicted by | mlx@peptide |
| predicted at | 2026-04-24 |
▸citationbibtex
@peptide{pep04439,
sequence = {HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS},
target = {glp-1r},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}