pe
pep-04439 v1 CC-BY-SA-4.0
1510152025303539
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Exenatide — Byetta/Bydureon, first-approved GLP-1 receptor agonist

39-aa GLP-1R agonist derived from Gila monster exendin-4; FDA-approved T2DM treatment; twice-daily (Byetta) or weekly XR (Bydureon); first-in-class GLP-1 agonist (2005); sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

status bioassayed target GLP-1R length 39 aa refs 3
fda-approvedglp-1-agonistdiabetesfirst-in-classincretin
snapshot approved 0% confidence
Class
GLP-1 receptor agonist (venom-derived synthetic peptide)
Status
FDA-approved prescription drug (Byetta 2005; Bydureon / Bydureon BCise 2012 / 2017); EMA, MHRA, Health Canada, TGA authorized
Best-supported effect
HbA1c reduction 0.8–1.9 percentage points and modest weight loss (~3–5 kg) in adults with type 2 diabetes, across Phase III trials and 15+ years of post-marketing data (human — approved label)
Main caveat
No FDA weight-management indication; EXSCEL cardiovascular outcomes trial neutral for MACE superiority (unlike liraglutide, semaglutide, dulaglutide); largely displaced by semaglutide, tirzepatide, and dulaglutide in current new-start clinical practice
status 5 / 5 · 2 contributors
prediction metrics boltz-2 1.0
ipTM0.855
pTM0.786
avg pLDDT72.4
ranking score0.751
overview readme

Snapshot

Class: GLP-1 receptor agonist (venom-derived synthetic peptide)
Evidence tier: Approved drug
Status: FDA-approved prescription drug (Byetta 2005; Bydureon / Bydureon BCise 2012 / 2017); authorized by EMA, UK MHRA, Health Canada, and Australia's TGA
Best-supported effect: Glycemic control (HbA1c reduction 0.8–1.9 percentage points) and modest weight reduction (~3–5 kg) in adults with type 2 diabetes, across extensive Phase III trials and more than 15 years of post-marketing data
Main caveat: No FDA weight-management indication; cardiovascular outcomes trial (EXSCEL) was neutral for MACE superiority, distinguishing exenatide from other GLP-1 agonists with positive CV signals; largely displaced in new-start practice by semaglutide, tirzepatide, and dulaglutide


What this is

Exenatide is a synthetic 39-amino-acid peptide modeled on exendin-4, a compound isolated from the salivary glands of the Gila monster (Heloderma suspectum), a venomous lizard native to the southwestern United States and northern Mexico. It shares approximately 53% sequence homology with human GLP-1 but carries a glycine residue at position 2 instead of alanine, which confers resistance to cleavage by dipeptidyl peptidase-4 (DPP-4) — the enzyme that degrades native GLP-1 within minutes. This structural difference was the key discovery by endocrinologist John Eng in the early 1990s and underpins the entire GLP-1 drug class. Exenatide is not extracted from lizards; it is manufactured by solid-phase peptide synthesis.

Exenatide was the first GLP-1 receptor agonist approved for clinical use. It is available in two distinct formulations: Byetta (short-acting, twice-daily subcutaneous injection) and Bydureon / Bydureon BCise (extended-release weekly microsphere formulation). As the first-in-class agent, it established proof of concept for GLP-1 receptor agonism in type 2 diabetes but has since been largely superseded by agents with greater HbA1c and weight-loss efficacy and stronger cardiovascular outcomes data. Its ongoing clinical role is primarily in patients already established on therapy or those with cost, insurance, or tolerability considerations.


Evidence map

Evidence layerGradeWhat it supports
HumanApproved — extensiveHbA1c reduction 0.8–1.9 percentage points; modest weight loss (~3–5 kg); glycemic control in T2D across multiple Phase III trials (DURATION series and others) and 15+ years of post-marketing surveillance; EXSCEL cardiovascular outcomes trial (n=14,752) showed non-inferiority but not MACE superiority
AnimalStrongExendin-4 biology and GLP-1R pharmacology are comprehensively characterized in animal models; rodent C-cell tumor findings underpin the class boxed warning
In vitroStrongGLP-1 receptor binding, cAMP/PKA signaling pathway, DPP-4 resistance mechanism, and microsphere release pharmacology are well-characterized
ComputationalNone identifiedNo computational prediction data attached
MechanismStrongGLP-1R agonism with downstream cAMP/PKA signaling is verified; DPP-4 resistance mechanism is established at the structural level

Claim check

ClaimVerdictEvidence layerConfidence
Reduces HbA1c and improves glycemic control in adults with type 2 diabetesSupportedHuman — Phase III trials and FDA labelHigh
Reduces body weight in T2D patientsSupported — modest effect (~3–5 kg typical)Human — Phase III trials and FDA labelHigh
Provides cardiovascular event superiority (MACE reduction)Not established — EXSCEL neutral for superiorityHuman — EXSCEL outcomes trial (n=14,752)High — trial completed; superiority not demonstrated
Equivalent to semaglutide or tirzepatide for weight lossContradicted / not supportedHuman — head-to-head and network meta-analysesHigh
Equivalent to semaglutide or tirzepatide for cardiovascular outcomesNot establishedHuman — CV outcomes trials differ across GLP-1 classHigh
Approved for weight management as a primary indicationContradicted / not approvedHuman — FDA label (diabetes indication only)High
Safe for type 1 diabetes useNot applicable / not approvedHuman — label exclusionHigh
Pediatric type 2 diabetes use (Bydureon BCise, age 10+)Supported — narrower evidence base than adultsHuman — pediatric indication labelingMedium — long-term pediatric data thinner than adult data

Exposure studied

This section reports exposure used in FDA-labeled and trial-studied contexts. It is not a personalized protocol.

ContextPopulationExposure studiedDurationEndpointLimitation
FDA label — ByettaAdults with type 2 diabetes5 mcg SC twice daily (first month), escalating to 10 mcg twice daily; administered within 60 minutes before morning and evening mealsChronic / ongoing; not cycledHbA1c reduction; glycemic controlShort half-life (~2.4 h) requires meal-timed dosing; not recommended with eGFR <30 mL/min/1.73m²
FDA label — Bydureon / BCiseAdults with type 2 diabetes2 mg SC once weekly; fixed dose, no titration; microsphere suspension or autoinjectorChronic / ongoing; steady state reached at approximately 6–7 weeksHbA1c reduction; glycemic controlInjection-site nodules characteristic; microsphere depot continues releasing drug ~10 weeks after last injection; not recommended with severe renal impairment
Phase III trials — DURATION seriesAdults with type 2 diabetesTrial regimens for once-weekly extended-release exenatideUp to 6 years (DURATION-1 open-label extension)HbA1c; body weight; tolerabilityOpen-label extension; see
EXSCEL cardiovascular outcomes trialAdults with type 2 diabetes; broad CV risk profileOnce-weekly extended-release exenatide vs. placebo added to usual careMedian 3.2 yearsMACE (cardiovascular death, nonfatal MI, nonfatal stroke); all-cause mortality; heart-failure hospitalizationNeutral for MACE superiority; non-inferiority met; see
Pediatric label — Bydureon BCisePatients aged 10 years and older with type 2 diabetes2 mg SC once weeklyPediatric indication; long-term data limitedHbA1c reductionLong-term efficacy and safety data in pediatric T2D thinner than in adults

Safety signals

SignalFrequency / contextNotes
NauseaCommon, especially at initiationMost frequent GI adverse event; generally dose-dependent and attenuates over time
VomitingCommonGI effect consistent with GLP-1 class
DiarrheaCommonGI effect consistent with GLP-1 class
Injection-site nodulesCharacteristic of Bydureon formulationConsequence of microsphere depot; generally non-serious but persistent
Thyroid C-cell tumorBoxed warningClass risk based on rodent C-cell findings; human relevance debated; absolute contraindication in personal or family history of medullary thyroid carcinoma (MTC) or MEN2
Acute pancreatitisPost-marketing signalRare; label caution; absolute contraindication in history of severe or recurrent pancreatitis
HypoglycemiaRisk elevated when co-administered with insulin or sulfonylureasNot intrinsic to monotherapy; dose reduction of concomitant secretagogue or insulin required when adding exenatide
Renal impairment / acute kidney injuryPost-marketing signalExenatide is renally cleared; not recommended with eGFR <30 mL/min/1.73m²; acute kidney injury signals in post-marketing context
Delayed gastric emptying effects on co-medicationsInteraction signal from labelClinically relevant for narrow-therapeutic-index oral drugs; INR monitoring advised with warfarin; oral contraceptives and oral antibiotics timing affected
Delayed gastric emptying worseningCaution in gastroparesisGLP-1 agonism slows gastric emptying; significant GI motility disorders are a labeled caution
Long-term microsphere depot tissue effectsNot establishedInjection-site nodule consequences of repeated microsphere deposition over years not rigorously characterized
Pregnancy and breastfeedingLabeled cautionAnimal reproductive toxicity; absence of human safety data; Bydureon depot means ~10-week washout is relevant pre-pregnancy planning
Long-term cardiovascular outcomesNeutral MACE trialEXSCEL showed non-inferiority (not harm) for MACE; directional signals on all-cause mortality and heart-failure hospitalization trended favorably; superiority not reached

Label safety exclusions (absolute contraindications per labeling): Personal or family history of medullary thyroid carcinoma (MTC); Multiple Endocrine Neoplasia syndrome type 2 (MEN2); severe renal impairment (eGFR <30 mL/min/1.73m²) or end-stage renal disease; history of severe or recurrent pancreatitis; type 1 diabetes; severe gastroparesis; prior serious hypersensitivity reaction to exenatide or formulation components.


Regulatory status

Region / bodyStatusNotes
US (FDA)Approved prescription drugByetta approved April 2005; Bydureon approved 2012; Bydureon BCise 2017; indication: type 2 diabetes in adults (Byetta) and adults and patients aged ≥10 (Bydureon BCise); no weight-management indication
EU (EMA)AuthorizedAuthorized for type 2 diabetes; per available sources authorization; current authorization status not independently refreshed in this card
UK (MHRA)Authorizedper available sources authorization for type 2 diabetes
Canada (Health Canada)Authorizedper available sources authorization for type 2 diabetes
Australia (TGA)Authorizedper available sources authorization; one of the first incretin-class drugs approved globally
WADANot specifically namedGLP-1 agonists are being monitored in weight-category sports; Per available sources, exenatide is not specifically named on the WADA Prohibited List; current list status not independently verified in this card
Compounding (US)Narrowed pathwayGeneric exenatide commercially available since early 2020s following patent expiration; compounding pathway has narrowed; subject to same post-shortage GLP-1 compounding restrictions; status not modeled in detail in this card

Clinical trials

Trial / sourcePhasePopulationEndpointStatus / result
DURATION-1 (Bydureon once-weekly pivotal program; uncontrolled open-label extension to 6 years)Phase IIIAdults with T2DHbA1c; tolerabilityCompleted; 6-year extension published
EXSCEL (cardiovascular outcomes trial;)Phase III / outcomesAdults with T2D; broad CV risk profileMACE (CV death, nonfatal MI, nonfatal stroke); all-cause mortality; heart-failure hospitalizationCompleted; neutral for MACE superiority; non-inferiority met; n=14,752

Additional controlled trials, network meta-analyses, and systematic reviews are cited in the available literature. Individual trial rows for the full DURATION series were not separately extracted in this card; see References for PMIDs including (DURATION-1 extension), (EXSCEL substudy), and systematic reviews across the exenatide trial program.

Last checked: 2026-05-07 (available literature date: March 1, 2026)


Mechanism

Exenatide is a full agonist at the GLP-1 receptor (GLP-1R), a class B G protein-coupled receptor expressed primarily on pancreatic beta cells, gut L-cells, and select neurons. Structural resistance to DPP-4 cleavage — conferred by glycine at position 2 of the peptide rather than the alanine present in native human GLP-1 — extends the half-life from approximately 2 minutes (native GLP-1) to approximately 2.4 hours for Byetta, and enables the Bydureon microsphere depot formulation to sustain therapeutic concentrations over 7 days.

Upon GLP-1R binding, exenatide activates adenylyl cyclase via Gs proteins, raising intracellular cAMP and activating protein kinase A (PKA). In pancreatic beta cells, this potentiates glucose-dependent insulin secretion and suppresses glucagon release — glucose-dependence is a key feature, as GLP-1R agonism does not stimulate insulin secretion in the absence of elevated glucose, limiting hypoglycemia risk in monotherapy. Additional downstream effects include delayed gastric emptying, which reduces postprandial glucose excursions, and central satiety signaling, which contributes to the observed weight reduction.

The Bydureon formulation uses poly(D,L-lactide-co-glycolide) microspheres for sustained release, achieving steady-state plasma concentrations after approximately 6–7 weeks of weekly dosing and maintaining drug release for approximately 10 weeks after the final injection.

Exenatide and native human GLP-1 share 53% sequence homology. Semaglutide, by contrast, shares 94% homology with human GLP-1 and uses a fatty-acid modification for albumin binding rather than DPP-4-resistance engineering — a mechanistic distinction that contributes to semaglutide's substantially longer half-life (~1 week) and greater receptor engagement efficiency.


Chemistry

FieldValue
OriginSynthetic analog of exendin-4, isolated from Heloderma suspectum (Gila monster) salivary peptides
Length39 amino acids
TopologyLinear
Homology to human GLP-153%
Key structural modificationGlycine at position 2 (vs. alanine in human GLP-1) — confers DPP-4 resistance
Half-life~2.4 hours (Byetta); sustained-release profile via microsphere depot (Bydureon)
Bydureon excipientPoly(D,L-lactide-co-glycolide) (PLG) microspheres
Sequence confidenceNot individually verified against primary chemistry source in this card; available literature does not provide the full amino-acid sequence
ManufactureSolid-phase peptide synthesis; not extracted from lizard tissue

Open questions

  • Mechanism behind the neutral EXSCEL cardiovascular result: Whether trial design, patient selection, adherence patterns, or exenatide's distinct pharmacology relative to other GLP-1 agonists explains the absence of MACE superiority — as seen with liraglutide (LEADER), semaglutide (SUSTAIN-6, SELECT), and dulaglutide (REWIND) — remains unresolved. Understanding this distinction could illuminate class-level vs. molecule-specific cardiovascular mechanisms.
  • Long-term tissue consequences of microsphere depot: Injection-site nodules are characteristic and common with Bydureon. Rigorous long-term characterization of repeated microsphere deposition and any associated subcutaneous tissue changes over years of continuous therapy has not been published, per the available literature.
  • Direct head-to-head comparisons at equipotent doses: Most comparative data on exenatide vs. semaglutide, tirzepatide, and dulaglutide come from network meta-analyses rather than directly randomized head-to-head trials at clinically matched exposures. The comparative efficacy picture at equipotent doses is less precisely characterized than meta-analyses suggest.
  • Pediatric long-term efficacy and safety: Bydureon BCise carries a pediatric indication (age 10+), but the evidence base for long-term efficacy and safety in pediatric type 2 diabetes is substantially thinner than the adult evidence base. This gap is particularly important as pediatric T2D prevalence rises.
  • Optimal current patient population: With semaglutide, tirzepatide, and dulaglutide dominating new starts due to superior HbA1c, weight, and cardiovascular outcomes, the patient populations for whom exenatide remains the preferred choice — beyond cost, access, or tolerability constraints — are not well-characterized by prospective data.
  • Cognitive effects of GLP-1 agonists including exenatide: available literature includes meta-analyses exploring GLP-1 agonist effects on cognition in Alzheimer's disease and mild cognitive impairment and in Parkinson's disease. Exenatide-specific cognitive evidence is not separately extracted in this card; these remain class-level exploratory signals.
STRUCTURE · PEP-04439 × GLP-1R
ranking0.751
target interface 4.5Å peptide drag rotate · scroll zoom · right-click pan
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8553479909896851 boltz-2
ranking score 0.7506198287010193 boltz-2
structural qualityopenfold3
metricvaluenote
gpde1.042global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). Exenatide — Byetta/Bydureon, first-approved GLP-1 receptor agonist (pep-04439, v1). PeptideModel. https://peptidemodel.com/card/pep-04439
@peptide{pep04439,
  sequence = {HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS},
  target   = {glp-1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
references 0 papers · 3 non-peer
in the news 3 articles
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use