pe
pep-05581 v1 CC-BY-SA-4.0

Histatin-1 antimicrobial peptide

A naturally derived peptide that kills or slows harmful bacteria; used only as a lab research tool.

statusbioassayed targetANTIMICROBIAL length57 aa refs1
antimicrobial
EARLY ENTRY This candidate is newly indexed — supporting evidence is still being added. Have a paper or data point? Contribute below.
status 2 / 5 · 0 verified on platform
prediction metrics boltz-2 2.2.1
ipTM0.000
pTM0.333
avg pLDDT57.6
ranking score0.527
STRUCTURE · PEP-05581 × ANTIMICROBIAL
ranking0.527
?
RECEPTOR UNKNOWN
peptide conformation only · no target structure
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
sequence57 aa
151015202530354045505557
MKFFVFALILALMISMTRA DSHEKRHHGYRRKFHEKHH SHREFPFYGDYGSNYLYDN
in the news 13 articles
Hypotheses5 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-11

Does histatin-1 kill or weaken microbes mainly by binding up zinc rather than by tearing holes in their membranes?

Understanding this could guide design of better antifungal or antibacterial peptides that target metal availability, a strategy that is harder for microbes to develop resistance against.

The hypothesis
The histidine-rich core HEKRHHGYRRKFHEKHHSHR of histatin-1 binds zinc ions with high affinity via His-X-His chelation motifs, and this zinc-chelation capacity rather than direct membrane disruption is the primary mechanism by which the peptide inhibits microbial metalloenzymes.
Why it’s plausible
Histatins are known zinc chelators, and the sequence contains at least three His-X-His or clustered His motifs. Zinc is a cofactor for many virulence-associated metalloproteinases in Candida and bacteria. Chelation-based inhibition is mechanistically distinct from membrane lysis (the dominant model for cationic AMPs) and could explain histatin-1's modest membrane-disrupting potency compared to histatin-5.
Why it matters
If zinc chelation drives activity, it explains why histatin-1 has a narrower spectrum than histatin-5, and suggests engineering higher-affinity chelating motifs could improve potency without requiring membrane-lytic cationic design.
Plausibility.70
Novelty.45
Impact.60
Basis · grounding1 paper · 1 computed/note
[1]
sequenceSequence contains HEK-RHH, FHEK-HHS, and additional His at positions creating potential His-X-His or bis-His zinc coordination geometry in the mature domain.
[2]
paper
Octapeptides related to histatin 8 show anticholinesterase activity in silico and in vitro, consistent with His-rich motifs binding metal-dependent enzyme active sites across the histatin family.
doi: 10.22159/ajpcr.2017.v10i6.17697
openupdated 2026-06-11

Does histatin-1 trigger cell movement and tissue repair through a receptor signaling pathway rather than by killing bacteria, and can a short core piece do the same?

If a short core motif drives wound healing through this pathway, it could be developed as a simple topical gel to help mouth sores, post-surgical wounds, or diabetic ulcers heal faster.

The hypothesis
Histatin-1 promotes oral wound healing not through antimicrobial action but through direct stimulation of epithelial cell migration via epidermal growth factor receptor (EGFR) transactivation, and this pro-migratory activity is retained by a short peptide spanning the GYRRKFHEK core sequence.
Why it’s plausible
Histatin-1 has been shown in the literature to accelerate wound closure in oral epithelium at sub-antimicrobial concentrations, implying a non-antimicrobial signaling role. The GYRRKFH segment contains basic residues and a Tyr that could serve as a receptor-interacting pharmacophore. EGFR and its family members are known to be activated by short cationic peptide fragments from salivary proteins, and the sequence contains a Tyr that could contribute to receptor phosphorylation mimicry.
Why it matters
Identifying the minimal wound-healing motif within histatin-1 would allow development of topical wound-healing agents far simpler and cheaper than the full peptide, with direct application to oral mucositis, post-surgical healing, and chronic wound treatment.
Plausibility.60
Novelty.50
Impact.70
Basis · grounding2 computed/notes
[1]
sequenceSegment GYRRKFHEK (positions ~23-31 of mature form) contains Tyr, two Arg, two Lys, and two His: a cationic, aromatic-containing pharmacophore consistent with growth-factor receptor binding motifs.
[2]
structurepLDDT 57.6 indicates conformational disorder, which is common in receptor-stimulating peptide hormones that adopt structure only upon receptor binding.
openupdated 2026-06-11

Does histatin-1 get inside Candida through the same fungal transporters that carry its relative histatin-5, explaining why it targets fungi more than bacteria?

If fungi cannot easily shut this entry route without harming themselves, histatin-1 derived antifungals could be harder for Candida to resist, which matters for immunocompromised patients.

The hypothesis
Histatin-1 preferentially targets fungal over bacterial membranes because the His-rich domain exploits the fungal-specific mitochondrial import pathway rather than membrane disruption, and the lack of a mitochondrial targeting sequence equivalent in bacteria explains the observed selectivity gap between Candida and Gram-positive bacterial killing.
Why it’s plausible
Histatin-5 is known to be translocated into Candida via the fungal-specific polyamine transporters Dur3/Dur31 and then targets mitochondria. Histatin-1 shares the His-rich cationic character but has a different C-terminal sequence. If histatin-1 also uses polyamine/mitochondrial import but with lower efficiency than histatin-5, the selectivity against Candida versus bacteria would be explained by differential membrane transporter presence without requiring membrane-lytic activity.
Why it matters
Confirming a transporter-mediated intracellular mechanism for histatin-1 would mean resistance could only arise by losing a transporter essential for fungal growth, making histatin-1 a harder target for resistance development than membrane-lytic AMPs.
Plausibility.55
Novelty.45
Impact.60
Basis · grounding2 computed/notes
[1]
sequenceMature domain cationic character (multiple Lys, Arg, His) is consistent with polyamine transporter substrate recognition seen for histatin-5 in Candida; Histatin-1 carries fewer positive charges than histatin-5 which may explain reduced but not absent antifungal potency.
[2]
structurepLDDT 57.6 with no clear amphipathic helix predicted (low confidence structure) argues against classic membrane-disruption as the sole mode of action, supporting an alternative internalization pathway.
openupdated 2026-06-11

Is the secreted, active form of histatin-1 the shorter mature peptide that remains after the front signal sequence is cleaved off?

This points drug developers and researchers to use the mature fragment rather than the full precursor, which would behave more like the natural secreted peptide and be simpler to make.

The hypothesis
The N-terminal hydrophobic stretch MKFFVFALILALMISMT of histatin-1 functions as a cleavable signal peptide that is removed in the mature secreted form, and antimicrobial/biological activity resides exclusively in the post-cleavage mature fragment beginning at RADSHEKRHHGYRRKFH rather than the full 57-aa sequence.
Why it’s plausible
The sequence MKFFVFALILALMISMT contains a classic signal peptide pattern (basic residue, hydrophobic core, polar cleavage region) consistent with ER-targeting. If this is cleaved co-translationally, the biological active unit is the ~40-aa histidine-rich C-terminal domain. Assay data comparing full precursor vs. mature fragment activity would distinguish a prodomain model from a full-length functional model.
Why it matters
Identifying the true active fragment matters for dosing and synthetic production. If the full 57-aa precursor is used in therapeutic or cosmetic formulations, inclusion of the hydrophobic signal region could alter aggregation state, membrane association, and potency relative to the endogenous mature form.
Plausibility.90
Novelty.15
Impact.50
Basis · grounding2 computed/notes
[1]
sequenceResidues 1-17 (MKFFVFALILALMISMT) contain a hydrophobic core flanked by basic Met and a polar threonine, consistent with a Type I signal peptide motif in salivary proteins.
[2]
structurepLDDT = 57.6 (low confidence overall) is consistent with an intrinsically disordered mature domain preceded by a structured signal sequence.
openupdated 2026-06-11

Does the aromatic, acidic end of histatin-1 contribute to holding the peptide onto tooth enamel, alongside its known anchoring regions?

If true, histatin-1 inspired coatings could be engineered into toothpastes or dental treatments that shield enamel from bacterial colonization.

The hypothesis
The C-terminal aromatic-rich segment FPFYGDYGSNYLYDN of histatin-1 mediates hydroxyapatite binding through tyrosine and the Asp/Asn acidic cluster, anchoring histatin-1 to tooth enamel and creating a surface-bound antimicrobial layer rather than a soluble antimicrobial agent.
Why it’s plausible
Hydroxyapatite-binding salivary proteins (statherin, proline-rich proteins) use phosphotyrosine or acidic clusters for mineral surface adsorption. The C-terminal tail of histatin-1 contains three Tyr, two Asn, one Asp, and two Pro residues in a region that structurally resembles acidic mineral-binding motifs. This would make histatin-1 a surface-coating peptide, consistent with its role in the acquired enamel pellicle.
Why it matters
If confirmed, histatin-1 could be exploited as a scaffold to anchor antimicrobial or remineralizing agents to tooth surfaces, with the C-terminal tail providing adhesion and the histidine-rich N-domain providing bioactivity.
Plausibility.55
Novelty.40
Impact.55
Basis · grounding2 computed/notes
[1]
sequenceC-terminal segment FPFYGDYGSNYLYDN contains Tyr at positions 3, 8, 12 (of the segment), flanking Asn/Asp residues consistent with mineral-surface binding motifs seen in statherin-class salivary proteins.
[2]
structureLow overall pLDDT (57.6) consistent with a two-domain architecture where the C-tail is conformationally flexible in solution but adopts a surface-bound conformation upon hydroxyapatite contact.
details expand to inspect
full evidence table1 metrics
metricvaluetool
ranking score 0.5270271897315979 boltz-2
3-letter notation
Met-Lys-Phe-Phe-Val-Phe-Ala-Leu-Ile-Leu-Ala-Leu-Met-Ile-Ser-Met-Thr-Arg-Ala-Asp-Ser-His-Glu-Lys-Arg-His-His-Gly-Tyr-Arg-Arg-Lys-Phe-His-Glu-Lys-His-His-Ser-His-Arg-Glu-Phe-Pro-Phe-Tyr-Gly-Asp-Tyr-Gly-Ser-Asn-Tyr-Leu-Tyr-Asp-Asn
recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights
hardwarevast_v100_32gb
mlx version
python
random seed1
msa strategynone_monomer
runtime
predicted by
predicted at2026-05-23
citationbibtex
peptidemodel (2026). Histatin-1 antimicrobial peptide (pep-05581, v1). PeptideModel. https://peptidemodel.com/card/pep-05581
@peptide{pep05581,
  sequence = {MKFFVFALILALMISMTRADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN},
  target   = {antimicrobial},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 5 by signal overlap
references 1 papers
[1] supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use