ABF-2 antimicrobial peptide
A naturally derived peptide that kills or stops the growth of bacteria and other microbes; used only as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could a single small change to ABF-2's structure stop it from falling apart before it reaches its target?
ABF-2 has one protein building block that appears to have no partner, which can cause the molecule to clump or get neutralized in wound fluid before doing its job. If swapping or pairing that one piece prevents this, the result could be a more shelf-stable, consistently effective antibiotic that is easier to manufacture, which matters for anyone developing it into a real treatment.
Could ABF-2, known as an antibacterial, also kill the fungal pathogens that often accompany bacterial infections?
Wound infections frequently involve both bacteria and fungi at the same time, yet most available drugs target only one or the other. If ABF-2 turns out to be active against Candida as well as bacteria, a single compound could address both threats simultaneously, which would be especially valuable in hard-to-treat infections in immunocompromised patients.
Does ABF-2 attack bacteria through two separate mechanisms, making it much harder for bacteria to resist?
When an antibiotic works through a single pathway, bacteria can sometimes evolve a workaround. If ABF-2 simultaneously disrupts the bacterial membrane and blocks cell-wall construction, bacteria would need to develop two independent defenses at the same time, which is far less likely. This could make it a stronger candidate in the fight against drug-resistant infections.
Could the compact folded shape of ABF-2 be what prevents it from damaging human cell membranes?
A common problem with antibiotic peptides is that they can be toxic to human cells as well as bacteria. If ABF-2's rigidity physically prevents it from inserting deeply into human cell membranes, that structural difference could explain a built-in safety margin. Understanding this would help researchers design safer variants, particularly for topical wound treatments.
Could ABF-2 kill bacteria that have already become resistant to our best antibiotics?
MRSA and carbapenem-resistant bacteria are among the most dangerous drug-resistant pathogens globally, responsible for tens of thousands of deaths each year. Because ABF-2 targets bacterial membranes rather than the molecular pathways that existing antibiotics rely on, the tricks bacteria use to resist conventional drugs would likely not protect them here. If confirmed in testing, this could establish a clear path toward clinical development.
Does ABF-2 work by physically breaking down the bacterial membrane rather than blocking a specific protein?
When an antibiotic works by blocking a specific protein, bacteria can evolve resistance by mutating that protein. If ABF-2 instead kills by physically disrupting the membrane itself, there is no single mutation that would protect bacteria, making resistance far less likely to emerge. Confirming this mechanism would strengthen the case for developing it as a treatment.
Could a shorter version of ABF-2 work just as well, costing less to make?
Manufacturing cost is one of the biggest barriers to turning peptide antibiotics into real drugs. If the first stretch of ABF-2 turns out to be dispensable for killing bacteria, researchers could focus on a shorter, cheaper-to-synthesize version. For anyone funding or developing this compound, that could be the difference between a viable product and one that never reaches patients.
▸full evidence table1 metrics
| metric | value | tool |
|---|---|---|
| ranking score | 0.5903340578079224 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | none_monomer |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep05476,
sequence = {MDIPGLDRAARALCIASCSLQNCATGNCEVREGRKTCVCSRCKDGGNVPLDKLIGIASKF},
target = {antimicrobial},
author = {peptidemodel},
year = {2026},
status = {computed}
}