pe
pep-00002 v1 CC-BY-SA-4.0 · 2K6O

LL-37: the body's own natural germ-killer

A germ-fighting peptide the human body makes naturally; it kills a broad range of bacteria and is used as a reference standard in lab research, not as an approved drug.

statusbioassayed targetANTIMICROBIAL length37 aa mass4493.33 Da refs44
antimicrobialcathelicidinampalpha-helicalfda-not-approvedreference-scaffold
status 2 / 5 · 0 verified on platform
prediction metrics boltz-2 2.2.1
ipTM0.000
pTM0.601
avg pLDDT85.1
ranking score0.801
STRUCTURE · PEP-00002 × ANTIMICROBIAL
ranking0.801
?
RECEPTOR UNKNOWN
peptide conformation only · no target structure
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
sequence37 aa
1510152025303537
LLGDFFRKSKEKIGKEFKR IVQRIKDFLRNLVPRTES
in the news 13 articles
overview readme

What this is

LL-37 is a 37-amino-acid antimicrobial peptide and the only cathelicidin found in humans. It is cut from a larger precursor protein called hCAP-18 (human cathelicidin antimicrobial peptide-18), which sits stored in the granules of neutrophils and is also made by epithelial cells lining the skin, gut, lungs, and reproductive tract. When infection or injury occurs, proteases — primarily proteinase 3 in neutrophils, and additional proteases at epithelial surfaces (Murakami and colleagues 2004) — cleave hCAP-18 and release the active LL-37 fragment into local tissues and secretions. LL-37 is also known as Human Cathelicidin Antimicrobial Peptide and cathelicidin.

LL-37 biology has been one of the most intensively studied chapters of innate immunity for three decades. Despite this depth of characterization, LL-37 has not reached regulatory approval as a therapeutic.


History

LL-37 was identified in the mid-1990s as the C-terminal antimicrobial fragment of hCAP-18. The gene encoding hCAP-18 — called CAMP — was characterized in 1996 by Gudmundsson and colleagues (Eur J Biochem 1996), establishing the structural framework for the precursor-to-active-peptide processing story. The name LL-37 derives from its two N-terminal leucine residues and its length of 37 amino acids.

Over the following decades, research documented LL-37's roles beyond direct microbial killing: as an immunomodulator that shapes dendritic cell differentiation and TLR signaling, as a promoter of wound healing and angiogenesis, and — notably — as a peptide whose expression is directly controlled by vitamin D via a vitamin D response element (VDR element) in the CAMP gene. The vitamin D–cathelicidin axis became one of the canonical examples linking micronutrient status to innate immune defense.

A distinct thread in the literature documents contexts where LL-37 is harmful rather than protective: in rosacea, psoriasis subsets, and lupus, aberrant LL-37 processing contributes to inflammatory pathology rather than resolving it (Durr and colleagues 2006).

LL-37 entered clinical investigation primarily in wound care. Multiple randomized trials have tested topical LL-37 in chronic venous leg ulcers and diabetic foot ulcers, and a small trial tested an oral formulation for SARS-CoV-2 infection. No formulation has reached regulatory approval.


What it does

LL-37 acts as both a direct antimicrobial and a signaling molecule for the immune system. In its antimicrobial role, it disrupts the membranes of bacteria, viruses, and fungi — Turner and colleagues (Antimicrob Agents Chemother 1998) characterized its activity against gram-negative and gram-positive organisms including Pseudomonas aeruginosa and multiply antibiotic-resistant pathogens. In its immune-signaling role, it draws immune cells to sites of infection, modulates how innate immune receptors respond to bacterial toxins, and can neutralize circulating bacterial lipopolysaccharide (LPS), a property characterized by Ciornei and colleagues (Antimicrob Agents Chemother 2005).

Beyond fighting infection, LL-37 promotes tissue repair by driving keratinocyte migration and proliferation, which is the mechanistic basis for the wound-healing trial program.

A critical nuance is that these effects are concentration- and context-dependent. At higher concentrations, LL-37 is toxic to mammalian cells as well — selectivity for pathogen membranes over host cell membranes is not absolute (Ciornei and colleagues 2005). In rosacea, psoriasis subsets, and lupus, elevated or aberrantly processed LL-37 drives inflammation rather than resolving it.


Evidence

  • Human: Completed randomized controlled trials for topical LL-37 in hard-to-heal venous leg ulcers (including a multicentric placebo-controlled trial, PMID 34687253) and in diabetic foot ulcers (randomized double-blind trial, PMID 37480520), with modest but positive effects on wound healing. A small randomized trial of oral LL-37 for SARS-CoV-2 omicron BA.5.1.3 infection reported efficacy and safety outcomes (PMID 37605995). Multiple vitamin D supplementation RCTs establish that correcting vitamin D deficiency reliably raises circulating LL-37 levels, consistent with the known VDR element in the CAMP gene. Systemic exogenous LL-37 administered by injection has not been tested in a controlled human trial.
  • Animal: Moderate preclinical evidence in infection and wound models, including a murine sepsis model (PMID 32825174) and antimicrobial efficacy studies against ESKAPE pathogens and cystic fibrosis isolates (Saiman and colleagues 2001; Narayana and colleagues 2019).
  • In vitro: Extensive and mechanistically well-characterized — broad-spectrum antimicrobial activity, LPS neutralization, keratinocyte migration, TLR modulation, and concentration-dependent host cell cytotoxicity are all documented.

Myths and misconceptions

  • "LL-37 is a natural antibiotic so it's safe and broadly beneficial to inject" — LL-37 is endogenously regulated in tightly controlled local and systemic ways. Exogenous administration bypasses that regulation. The peptide can be cytotoxic to mammalian cells at higher concentrations, and in rosacea, psoriasis subsets, and lupus, LL-37 dysregulation drives pathology rather than preventing it. "Natural antimicrobial" is not the same as "safe to inject chronically."
  • "Injecting LL-37 reproduces the immune benefits seen with vitamin D supplementation" — Vitamin D upregulates endogenous cathelicidin expression in tissues where it is biologically appropriate and corrects the deficit at the regulatory level. Injecting synthetic LL-37 systemically delivers peptide to compartments and concentrations that endogenous regulation does not produce, and this has not been shown in clinical studies to reproduce vitamin D's effects.
  • "LL-37 is FDA-approved for wound healing" — Topical LL-37 has been studied in clinical trials for chronic wounds with positive but modest results. It is not FDA-approved for wound healing or any other indication.
  • "Research-chemical LL-37 is the same as the LL-37 used in published trials" — Clinical trial preparations are produced under quality systems with identity, purity, sterility, and endotoxin controls. Research-chemical preparations offer none of those guarantees — particularly important for an immune-active peptide where endotoxin contamination could independently trigger inflammatory responses.

Known effects

  • Antimicrobial activity (bacteria, viruses, fungi) — Extensively characterized in vitro; activity against gram-positive and gram-negative organisms including P. aeruginosa, multiply resistant cystic fibrosis isolates, and ESKAPE pathogens (Turner and colleagues 1998; Saiman and colleagues 2001; Narayana and colleagues 2019)
  • Chronic venous leg ulcer healing (topical) — Phase III / Completed RCTs; modest effect sizes
  • Diabetic foot ulcer healing (topical) — Completed RCT; limited replication to date
  • Oral antiviral (SARS-CoV-2) — One small completed RCT; no replication
  • Endogenous level modulation via vitamin D — Well-supported through multiple RCTs; CAMP VDR element mechanism well characterized
  • Wound healing and angiogenesis (preclinical) — Preclinical; mechanistic data in tissue models
  • LPS neutralization — In vitro and preclinical; anti-endotoxin activity characterized (Ciornei and colleagues 2005)

Safety signals

Concentration-dependent cytotoxicity: LL-37 can be toxic to mammalian cells at higher concentrations. Selectivity for pathogen membranes over host membranes is not absolute (Ciornei and colleagues 2005). The safety margin for systemic exogenous use in humans has not been characterized.

Context-dependent pro-inflammatory effects: In rosacea, psoriasis subsets, and lupus, dysregulated LL-37 processing contributes to inflammatory pathology. Exogenous LL-37 in individuals with these conditions may worsen rather than improve symptoms.

No pharmacokinetic data for systemic injection: Absorption, distribution, half-life, and tissue uptake of synthetic LL-37 injected systemically have not been characterized in humans.

Research-chemical quality: Synthetic LL-37 sold outside regulated supply chains has no guaranteed identity, purity, sterility, or endotoxin control. For an immune-active peptide, endotoxin contamination is a particularly relevant concern.

Cancer context: LL-37 has pro-angiogenic activity; complex context-dependent effects on tumor biology are described in available sources.


Regulatory status

  • US (FDA): Not approved for any indication. Topical and oral investigational formulations have been tested in trials but have not reached approval. Synthetic LL-37 sold through research-chemical channels is not authorized for human therapeutic use; the FDA's 2023 review of compounded peptides narrowed the legitimate compounding pathway for peptides in this category.
  • EU (EMA): No marketing authorization.
  • UK (MHRA): No license.
  • Canada: Investigational only.
  • Australia (TGA): No approval; general enforcement action taken against unapproved peptide sales.
  • WADA: LL-37 is not specifically named on the prohibited list but falls under the S0 catch-all for substances not approved by any governmental health authority for human therapeutic use. Current list status not independently refreshed in this card.

Mechanism

LL-37's antimicrobial activity operates primarily through direct physical disruption of pathogen membranes. The peptide adopts an amphipathic alpha-helical structure in lipid environments (Wang and colleagues 2008, J Biol Chem), with positively charged and hydrophobic faces that allow it to insert into and disrupt bacterial membranes via carpet-like or toroidal pore mechanisms. The N-terminal region does not form an amphipathic helix, while the core region (approximately residues 17–32) contains the primary antimicrobial pharmacophore (Wang and colleagues 2018). The same mechanism underlies both antimicrobial activity and host-cell cytotoxicity at higher concentrations.

Beyond membrane disruption, LL-37 acts as an immune modulator through the formyl peptide receptor 2 (FPR2/ALX), a G-protein-coupled receptor expressed on immune cells (Cattaneo and colleagues 2013). Activation of FPR2 by LL-37 elicits distinct signaling cascades depending on ligand context. LL-37 also binds and neutralizes LPS by competing with its interaction at TLR4. The CAMP gene carries a vitamin D response element (VDR element); in multiple tissue types, vitamin D directly upregulates cathelicidin transcription, making LL-37 expression a functional readout of vitamin D status (Gudmundsson and colleagues 1996).


Open questions

  • Systemic injection efficacy — The most common community self-administration route has no controlled human evidence. Whether injectable LL-37 produces any of the wound-healing effects demonstrated with topical preparations is unknown.
  • Safety margin for systemic use — Concentration-dependent cytotoxicity and the absence of PK/PD data in humans leave the therapeutic window for systemic exogenous LL-37 undefined.
  • Long-term safety — Chronic immune modulation by exogenous LL-37 has not been studied at any dosing scale or duration.
  • Disease-context selectivity — In rosacea, psoriasis subsets, and lupus, LL-37 can be pathogenic. Predictive markers for benefit vs. harm are lacking.
  • Research-chemical equivalence — Whether research-chemical preparations produce equivalent peptide to clinical-trial preparations, and how endotoxin variation affects immunological outcomes, is not characterized.
Hypotheses7 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Is there a precise concentration threshold below which LL-37 safely directs immune cells and above which it starts destroying both germs and your own cells indiscriminately?

If this dose-switch is real, drug designers could keep LL-37 below the danger level to get the immune benefits without the toxicity, which is the main reason this natural peptide has never become an approved medicine.

The hypothesis
LL-37's concentration-dependent shift from FPR2 agonist signaling to non-selective membrane disruption is governed by a critical monomer-to-oligomer transition, such that below the oligomerization threshold LL-37 acts as a selective FPR2 agonist with low cytotoxicity, and above it acts as a non-selective membranolytic agent.
Why it’s plausible
The evidence documents that LL-37 is cytotoxic to mammalian cells at concentrations similar to its MIC values (13-25 uM causes human leukocyte death; Ciornei 2005), yet receptor-mediated immunomodulation occurs at lower concentrations. This biphasic behavior is consistent with amphipathic helical peptides that self-assemble into membrane-active oligomers above a concentration threshold. Below the critical aggregation concentration, monomeric LL-37 presents a defined receptor-binding surface to FPR2. Above it, helical oligomers disrupt both pathogen and host membranes indiscriminately. The selectivity axis hit documents that LL-37 activates different receptors in a cell-type and context-dependent manner (10.1016/j.cellimm.2012.11.009), which is best explained by concentration-dependent partitioning between receptor engagement and membrane disruption. The Boltz-2 monomer prediction (ptm=0.60, avg_plddt=85.1) captures a well-structured monomer, but the iptm is null, indicating no co-complex was modeled.
Why it matters
If this concentration-dependent switch is real, then formulations or modifications that keep LL-37 below the oligomerization threshold in vivo would preserve receptor-mediated immunomodulatory effects while eliminating cytotoxicity, resolving the core therapeutic index problem that has prevented LL-37 from reaching regulatory approval.
Plausibility.70
Novelty.57
Impact.77
Basis · grounding2 papers · 1 computed/note
[1]
paper
13-25 uM LL-37 causes human leukocyte and T-cell death; similar concentrations lyse red blood cells, overlapping with MIC values, characterizing LL-37 as 'comparatively unspecific.'
doi: 10.1016/j.bbamem.2006.03.030
[2]
paper
LL-37 activates multiple receptors depending on cell type and context; one explanation is that effects are concentration-dependent.
doi: 10.1016/j.cellimm.2012.11.009
[3]
structureBoltz-2 monomer: ptm=0.60, iptm=null. Moderate per-residue confidence consistent with a peptide that is structured as a monomer but whose oligomeric state is not captured.
openupdated 2026-06-05

If LL-37 is chemically attached to a collagen-based wound dressing, will it slowly release at levels that kill bacteria but stay too low to hurt the patient's own cells?

For people with hard-to-heal wounds like diabetic foot ulcers, this could mean a single dressing that fights infection for two weeks without the tissue damage that has blocked LL-37 from clinical use, requiring no changes to the peptide itself.

The hypothesis
Covalent tethering of LL-37 to a collagen-binding domain (CBD) peptide converts LL-37 from a rapidly diffusing, concentration-limited agent into a matrix-retained depot that maintains sub-cytotoxic but antimicrobially active concentrations at wound surfaces for at least 14 days, resolving the concentration-cytotoxicity problem in wound healing.
Why it’s plausible
The evidence explicitly documents that CBD modification of LL-37 (cCBD-LL37 and fCBD-LL37) facilitates retention on collagen scaffolds with preserved binding and antimicrobial activity for 14 days (10.1016/j.actbio.2016.12.047), whereas unmodified LL-37 loses activity from collagen scaffolds over the same period. The readme and safety section identify concentration-dependent cytotoxicity as the key unresolved problem: the MIC and cytotoxic concentration overlap (13-25 uM for host cell toxicity vs. similar MIC values). A collagen-tethered depot would release LL-37 at sub-cytotoxic local concentrations while maintaining sustained antimicrobial coverage. The RCT data for topical LL-37 in venous leg ulcers (PMID 34687253) shows modest but positive effects despite the concentration-cytotoxicity issue; CBD engineering is predicted to sharpen this effect size.
Why it matters
This is a direct path to an engineered wound-care biologic that overcomes the therapeutic index limitation of free LL-37 without requiring sequence changes, using an already-characterized modification strategy. If the scientific claim (sub-cytotoxic depot concentrations are sufficient for antimicrobial benefit) is true, it de-risks clinical translation significantly.
Plausibility.82
Novelty.43
Impact.68
Basis · grounding2 papers · 1 computed/note
[1]
paper
CBD modification retains LL-37 binding and activity on collagen scaffolds for 14 days; unmodified LL-37 loses activity at the same timepoint.
doi: 10.1016/j.actbio.2016.12.047
[2]
paper
Host cell cytotoxicity at 13-25 uM, overlapping with MIC values, is the core therapeutic index problem for free LL-37.
doi: 10.1016/j.bbamem.2006.03.030
[3]
notePhase III RCT for venous leg ulcers (PMID 34687253) shows modest positive effect; CBD engineering hypothesis would predict improved effect size if depot concentration stays below cytotoxic threshold.
openupdated 2026-06-05

At safe, natural concentrations, does LL-37 dampen a key inflammation trigger in immune cells, reducing the harmful flare-up signals behind gout attacks and related conditions?

If confirmed, LL-37 or a close relative could open a new treatment path for gout, rare inherited fever syndromes, and other diseases driven by this inflammation pathway, conditions where current options are limited or cause side effects.

The hypothesis
LL-37 is an endogenous inhibitor of NLRP3 inflammasome assembly in macrophages via P2X7 receptor desensitization, such that LL-37 at physiological innate-immune concentrations (not cytotoxic) dampens IL-1 beta and IL-18 secretion during sterile inflammation, making it relevant for gout, CAPS (cryopyrin-associated periodic syndromes), and other inflammasomopathies.
Why it’s plausible
The evidence documents that LL-37 directly activates P2X7 receptor via specific binding (10.1016/j.bbamem.2006.03.030). P2X7 is the canonical activating receptor for NLRP3 inflammasome assembly: extracellular ATP activates P2X7, causing K+ efflux that triggers NLRP3. However, sustained or high-affinity P2X7 engagement can cause receptor desensitization and pore formation rather than brief signaling, which at lower agonist concentrations can preemptively desensitize P2X7 to subsequent ATP-triggered NLRP3 activation. At physiological tissue concentrations, LL-37 as a P2X7 partial agonist or biased agonist could thus suppress NLRP3 activation rather than trigger it. The in vivo evidence of LL-37 modulating IL-17A and IL-10 (10.1016/j.bbamem.2019.07.012) and its known role in lupus pathology (where NLRP3 is active) are consistent with this. The repurposing angle is genuinely novel: no current LL-37 literature frames it as an inflammasome suppressor for CAPS or gout.
Why it matters
NLRP3-driven diseases represent a large unmet need (gout flares, CAPS, NASH, type 2 diabetes). If LL-37 or a P2X7-biased derivative suppresses NLRP3 at sub-cytotoxic concentrations, it opens an entirely new therapeutic category for this well-characterized human peptide, orthogonal to its antimicrobial and wound-healing development history.
Plausibility.43
Novelty.80
Impact.75
Basis · grounding2 papers · 1 computed/note
[1]
paper
LL-37 directly activates P2X7 via specific binding; P2X7 is the canonical upstream activator of NLRP3 inflammasome.
doi: 10.1016/j.bbamem.2006.03.030
[2]
paper
LL-37 receptor activation is cell-type and context dependent; P2X7 downstream calcium release and PKC activation can lead to divergent outcomes including cell death or signaling.
doi: 10.1016/j.cellimm.2012.11.009
[3]
noteIn lupus and psoriasis subsets, aberrant LL-37 processing drives inflammation; this context-dependence is consistent with dose-dependent P2X7 agonism versus desensitization.
openupdated 2026-06-05

Is the standard label for LL-37, "antimicrobial," hiding its more important role as a molecule that switches on specific immune receptors in the body?

Reclassifying LL-37 by its receptor targets could let researchers compare it to a whole family of related drugs, design better versions, and unlock immune-modulating uses that its current germ-killer label obscures.

The hypothesis
The annotated target 'antimicrobial' for LL-37 is a functional category, not a molecular target; the primary immune-signaling molecular target is FPR2 (formyl peptide receptor 2), and the card should be reannotated with FPR2 as primary receptor target alongside P2X7 as a co-target.
Why it’s plausible
The evidence bundle documents that LL-37 directly activates at least three named receptors: FPRL-1/FPR2 via direct binding, P2X7 via direct binding, and EGFR via transactivation only (10.1016/j.bbamem.2006.03.030). The current annotation lists 'antimicrobial' as the sole target, which is a phenotypic category. LL-37's immunomodulatory effects, chemotaxis, wound healing, and angiogenesis all downstream of FPR2 activation are as biologically significant as its membrane-disruptive antimicrobial action. The monomer structure prediction (avg_plddt=85.1) predicts a well-folded C-terminal helix, consistent with a defined binding interface rather than purely non-specific membrane disruption. Missannotating the target as a function class rather than a receptor obscures the drug-receptor relationship and distorts comparisons to other FPR2 ligands.
Why it matters
Correcting the annotation to FPR2 as primary receptor target enables rational comparison of LL-37 with other FPR2 agonists (e.g., annexin A1 peptides, lipoxin A4 analogues), opens structure-activity work at the FPR2 binding interface, and correctly frames the therapeutic potential of LL-37 derivatives as receptor agonists rather than non-specific membrane disruptors.
Plausibility.85
Novelty.27
Impact.60
Basis · grounding2 papers · 1 computed/note
[1]
paper
LL-37 proven to activate FPRL-1 and P2X7 via direct binding; EGFR activation is transactivation only.
doi: 10.1016/j.bbamem.2006.03.030
[2]
paper
Overview of receptors activated by LL-37 including FPR2, P2X7, EGFR; downstream pathways involve calcium release, PKC, NF-kB.
doi: 10.1016/j.cellimm.2012.11.009
[3]
structureavg_plddt=85.1 for monomer indicates a structured fold consistent with a defined receptor-binding surface in the helical core.
openupdated 2026-06-05

Would a topical LL-37 treatment clear acne better than antibiotics alone by both killing Cutibacterium acnes and blocking the inflammation signal that turns an infection into an angry red pimple?

With antibiotic-resistant acne on the rise and roughly 650 million people affected worldwide, a single topical agent that addresses both the microbial cause and the inflammatory reaction could offer a genuinely new option, especially for people for whom current treatments have stopped working.

The hypothesis
Topical LL-37 is effective for acne vulgaris associated with Cutibacterium acnes biofilm, where its combined direct antimicrobial activity against C. acnes and its FPR2-mediated suppression of inflammasome-driven IL-1 beta release in sebocytes produce synergistic therapeutic benefit superior to antibiotics alone.
Why it’s plausible
The readme documents that LL-37 has completed RCTs for chronic venous leg ulcers and diabetic foot ulcers, but acne vulgaris has not been trialled. C. acnes forms biofilms in follicular ducts; the ESKAPE-pathogen and biofilm efficacy data (Narayana 2019) suggest LL-37 is active against gram-positive biofilm-forming organisms. Crucially, C. acnes triggers TLR2 and NLRP3 inflammasome signaling in sebocytes, releasing IL-1 beta that drives the inflammatory component of acne. LL-37's FPR2 agonism is documented to modulate TLR signaling and downstream cytokine responses. In rosacea (where LL-37 dysregulation is pathogenic), the LL-37 processed by KLK5 kallikrein drives inflammation, but exogenous LL-37 in controlled doses could shift the balance. The skin and sebaceous duct is a topical compartment where concentration can be controlled, avoiding the systemic cytotoxicity concern.
Why it matters
Acne vulgaris affects approximately 650 million people globally; antibiotic resistance in C. acnes is rising. A peptide that simultaneously kills the pathogen and suppresses the downstream inflammatory cascade would represent a mechanistically differentiated topical agent addressing both microbial and inflammatory components of the disease.
Plausibility.52
Novelty.68
Impact.63
Basis · grounding2 papers · 1 computed/note
[1]
noteLL-37 drives keratinocyte migration/proliferation and modulates TLR signaling; expression is skin-relevant (epithelial cells).
[2]
paper
LL-37-derived 17tF-W suppresses TNF-alpha and modulates IL-17A, IL-10 in catheter biofilm model, documenting the anti-biofilm and immunomodulatory combination.
doi: 10.1016/j.bbamem.2019.07.012
[3]
paper
LL-37 activates FPR2 and P2X7; FPR2 signaling modulates innate immune receptor responses relevant to sebocyte inflammasome activation.
doi: 10.1016/j.bbamem.2006.03.030
openupdated 2026-06-05

Is the loose, unstructured front end of LL-37 actually muffling its own activity, so that a shorter version without it would activate immune receptors more strongly and kill bacteria at lower doses?

If that first segment acts as a natural brake, trimmed versions of LL-37 could be more targeted, less toxic, and more useful as a starting point for wound-healing or anti-inflammatory drug candidates.

The hypothesis
The disordered N-terminal segment of LL-37 (residues 1-12, LLGDFFRKSKEK) acts as an autoinhibitory module that attenuates FPR2 activation and antimicrobial potency, such that truncation or removal of this segment produces a peptide with higher FPR2 agonist potency and lower MIC against gram-negative organisms.
Why it’s plausible
The literature explicitly states that the N-terminal region of LL-37 does not readily form an amphipathic alpha-helix (10.1016/j.bbamem.2006.03.030), while the C-terminal core (residues 13-37, including KR-12 at residues 18-29) retains antimicrobial activity. The N-terminal region contains several charged residues (R8, K10, K12) that could electrostatically interact with the helical core and reduce its accessibility to FPR2. Structurally, if the non-helical N-terminus folds back against the amphipathic helix in solution, it would reduce the exposed hydrophobic face that is likely involved in receptor engagement. Removal of this segment should relieve this autoinhibition. The fragment KR-12 is noted in the ref titles as the smallest antimicrobial fragment derived from LL-37, supporting that the C-terminal core is the active element.
Why it matters
If the N-terminal 12 residues are autoinhibitory at FPR2, then synthetic truncation variants would be potentiated FPR2 agonists with improved receptor selectivity and potentially reduced cytotoxicity, providing a rational engineering pathway for wound-healing or anti-inflammatory candidates derived from LL-37.
Plausibility.47
Novelty.67
Impact.60
Basis · grounding2 papers · 1 computed/note
[1]
paper
The N-terminal region (right end) does not readily form an amphipathic alpha-helix, per structural figure caption.
doi: 10.1016/j.bbamem.2006.03.030
[2]
paper
Reference title: structures of LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles, indicating the C-terminal core is sufficient for activity.
doi: 10.1074/jbc.m805533200
[3]
sequenceResidues 1-12 are LLGDFFRKSKEK, with charged K and R residues that could sterically or electrostatically occlude the amphipathic helix of the C-terminal domain.
openupdated 2026-06-05

Instead of simply grabbing the bacterial toxin (LPS) in the blood, does LL-37 actually dock onto the immune receptor itself and lock it in a closed position so it cannot fire the dangerous sepsis cascade?

If LL-37 works at the receptor level rather than just soaking up toxin, it would point to a precise docking site that chemists could use to design new anti-sepsis drugs, a condition that kills millions of people each year and has very few targeted therapies.

The hypothesis
LL-37 suppresses TLR4 signaling not via competitive LPS sequestration but via direct allosteric engagement of the TLR4/MD-2 co-receptor complex at the LPS-binding groove, displacing LPS after it has bound and triggering a conformational change that prevents TLR4 dimerization.
Why it’s plausible
The evidence documents that LL-37 neutralizes circulating LPS (Ciornei 2005), which has been attributed to direct LPS binding in solution. However, the mechanism by which this translates to inhibition of TLR4 signaling is not established. The sequence of LL-37 contains the amphipathic helix with a hydrophobic face (residues F17, F27, L28, L31 in the RIVQRIKDFLRNLVPR segment) structurally homologous to the lipid A acyl chain binding cleft of MD-2. IQ-motif peptides (from 10.1016/j.biochi.2012.12.004) that bind LPS better than LL-37 do not necessarily suppress TLR4 signaling more effectively, suggesting that LPS sequestration in solution and TLR4 signaling inhibition are dissociable mechanisms. The intracellular signaling data (the axis hit for mechanism, 10.1097/moh.0b013e32831ac517) documents that LL-37 can enter the cytosol, but the extracellular LPS neutralization must operate upstream of TLR4 dimerization.
Why it matters
If LL-37 acts on the TLR4/MD-2 complex directly rather than sequestering LPS in solution, then the MD-2 binding interface defines a new pharmacophore for anti-sepsis drug design derived from the LL-37 scaffold, distinct from current anti-LPS approaches.
Plausibility.37
Novelty.63
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
sourceIQ-motif peptides bind LPS better than LL-37 from some species; differential LPS binding versus functional TLR4 suppression implies distinct mechanisms.
[2]
paper
LL-37 LPS neutralization documented; attributed to direct LPS binding but the receptor-level mechanism at TLR4/MD-2 is not resolved.
doi: 10.1016/j.bbamem.2006.03.030
[3]
sequenceHydrophobic face residues F17, I20, F27, L28, L31 in the amphipathic helix are candidates for insertion into the hydrophobic groove of MD-2.
details expand to inspect
full evidence table1 metrics
metricvaluetool
ranking score 0.8009225726127625 boltz-2
3-letter notation
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights
hardwarevast_v100_32gb
mlx version
python
random seed1
msa strategynone_monomer
runtime
predicted by
predicted at2026-05-23
citationbibtex
peptidemodel (2026). LL-37: the body's own natural germ-killer (pep-00002, v1). PeptideModel. https://peptidemodel.com/card/pep-00002
@peptide{pep00002,
  sequence = {[LL-37, 37 aa]},
  target   = {antimicrobial},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 1 by signal overlap
clinical trials 7 on ct.gov · 12 on EUCTR · checked 2026-05-09
ct.gov trials ? 7
with results 5
EUCTR 12
by phase
3phase 24phase 31no phase
by status
2completed1recruiting4terminated
references 44 papers
[1] source scaffold
[7]
Peptide inhibitors against herpes simplex virus infections
Galdiero, S. et al. Journal of Peptide Science 2013
supporting
[11] supporting
[28] supporting
[37] supporting
[38]
The Cathelicidins – Structure, Function and Evolution
Tomasinsig, L. et al. Current Protein & Peptide Science 2005
supporting
[42] supporting
[43] supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use