rhodopsin-like GPCR (class A) · human

OPRM1

mu-opioid receptor
mu-type opioid receptor · UniProt P35372 · gene OPRM1
pain

OPRM1 is the primary target for opioid analgesics. Endogenous peptide ligands include beta-endorphin and met-enkephalin (from POMC and PENK precursors). Ziconotide (Prialt, from cone snail venom) and dermorphin are peptide drugs/candidates in this space.

browse 33 cards → upload → try → + watch target

anchor card · canonical reference for this target

anchor

Beta-endorphin: the brain's own natural painkiller

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE · 31 aa · @peptidemodel

bioassayed pep-04445 @peptidemodel refs: 1

all cards · 33 candidates against OPRM1

# id title author status refs IC50 ♥
1 pep-10704 Dynorphin A: natural opioid pain and stress signal (porcine form) pe@peptidemodel
13 — 0
2 pep-10702 Natural opioid brain peptide (Dynorphin A 1-13) pe@peptidemodel
10 — 0
3 pep-10700 Dynorphin A (1-10) amide: natural opioid fragment that boosts morphine pain relief pe@peptidemodel
9 — 0
4 pep-10699 Dynorphin A (1-8): natural pain-signaling brain peptide pe@peptidemodel
8 — 0
5 pep-10705 Brain pain-relief peptide, extended form (Met-enkephalin + arginine) pe@peptidemodel
7 — 0
6 pep-10714 Gliadorphin: wheat gluten fragment linked to autism and schizophrenia pe@peptidemodel
5 — 0
7 pep-10694 Dermorphin: ultra-potent natural opioid from tree-frog skin pe@peptidemodel
5 — 0
8 pep-04445 Beta-endorphin: the brain's own natural painkiller pe@peptidemodel
1 — 0
9 pep-10535 Nociceptin: brain peptide that shapes pain, stress, and mood (Orphanin FQ) pe@peptidemodel
3 — 0
10 pep-10534 Nociceptin (1-13) amide: lab fragment of a natural pain-signal peptide pe@peptidemodel
3 — 0
11 pep-10695 Frog-skin painkiller peptide (D-Met2-Deltorphin) pe@peptidemodel
2 — 0
12 pep-10693 Frog-skin opioid peptide (Deltorphin 1) pe@peptidemodel
2 — 0
13 pep-10611 26RFa brain-signaling peptide pe@peptidemodel
1 — 0
14 pep-10550 Brain-signaling neuropeptide that activates an orphan receptor (P52 peptide) pe@peptidemodel
1 — 0
15 pep-10425 Pain-blocking opioid research peptide (CHEMBL1927270) pe@peptidemodel
5 — 0
16 pep-10434 Morphine-receptor-binding research peptide (CYRTT / CHEMBL1795717) pe@peptidemodel
4 — 0
17 pep-10706 Painkiller-pathway research peptide (Pro3-Dynorphin A 1-11 amide) pe@peptidemodel
7 — 0
18 pep-10428 Pain-relieving peptide (CHEMBL216640) pe@peptidemodel
2 — 0
19 pep-10426 Dynorphin A look-alike: brain's own painkiller peptide (CHEMBL2028997) pe@peptidemodel
2 — 0
20 pep-10309 Dual opioid & hunger-signal research peptide (YGDF / CHEMBL206974) pe@peptidemodel
2 — 0
1–20 of 33

target literature · 58 curated papers

[1]
Sun, Z. et al. 2003 Peptides Findings in normal rats following administration of gliadorphin-7 (GD-7)
cited by
1
cards
[2]
Dreborg, S. et al. 2008 Proceedings of the National Academy of Sciences Evolution of vertebrate opioid receptors
cited by
2
cards
[3]
Stevens, C. 2009 Frontiers in Bioscience The evolution of vertebrate opioid receptors
cited by
5
cards
[4]
Pasternak, G. et al. 2013 Pharmacological Reviews Mu Opioids and Their Receptors: Evolution of a Concept
cited by
9
cards
[7]
Evans, C. et al. 1992 Science Cloning of a Delta Opioid Receptor by Functional Expression
cited by
4
cards
[9]
Huang, A. et al. 2022 Journal of Neuroscience Research Genetic and functional analysis of a Pacific hagfish opioid system
cited by
5
cards
[10]
Ko, M. et al. 2020 Handbook of Experimental Pharmacology Pleiotropic Effects of Kappa Opioid Receptor-Related Ligands in Non-human Primates
cited by
6
cards

discussion · 0 threads

No discussion threads yet.