OPRM1 is the primary target for opioid analgesics. Endogenous peptide ligands include beta-endorphin and met-enkephalin (from POMC and PENK precursors). Ziconotide (Prialt, from cone snail venom) and dermorphin are peptide drugs/candidates in this space.
OPRM1 encodes the mu (μ) opioid receptor - the primary target for all clinical opioid analgesics and the receptor responsible for both the therapeutic effects and the addiction, respiratory depression, and constipation that define the opioid crisis. Over 70,000 U.S. overdose deaths from synthetic opioids in 2023 were mediated through this receptor. MOP is also the target for opioid use disorder treatments (methadone, buprenorphine) and overdose reversal (naloxone, naltrexone). Biased agonism - selectively activating Gi over β-arrestin-2 - is the central strategy for developing safer opioids. OPRM1 generates >20 splice isoforms affecting trafficking and analgesic profiles.
OPRM1 (chromosome 6q25.2, ~400 aa core; >20 splice isoforms including MOR-1A through MOR-1X from C-terminus variation) is a Gi/o-primary class A GPCR. Endogenous agonists: β-endorphin (Ki ~1 nM, highest-affinity endogenous ligand), endomorphin-1 (Tyr-Pro-Trp-Phe-NH₂, Ki ~0.4 nM), endomorphin-2, [Met⁵]-enkephalin. Crystal structure of MOP (PDB: 4DKL, inactive; 5C1M active with BU72) defined the binding pocket: His297^{6.52} and Asp147^{3.32} coordinate the protonated amine of morphinan ligands; Tyr326^{7.43} and Trp293^{6.48} form the aromatic cage for tyramine/phenol ring. Signaling: Gi/o → ↓adenylyl cyclase → ↓cAMP → GIRK channel activation → hyperpolarization; N-type Ca²⁺ channel closure; β-arrestin-2 recruitment → receptor desensitization + GRK phosphorylation → internalization → tolerance. The β-arrestin-2 pathway is the proposed mechanistic basis for respiratory depression and tolerance, though this is debated. GRK3 phosphorylation of Ser375 in the C-tail is a key desensitization event. OPRM1 A118G (rs1799971, N40D) is the most pharmacogenetically significant human variant - the Asp40 allele creates an N-glycosylation site and alters β-endorphin affinity ~3-fold.
Approved agonists: morphine, oxycodone, hydromorphone, fentanyl, methadone (also NMDA antagonist), buprenorphine (partial agonist, high affinity Ki ~0.1 nM, used for OUD and pain). Oliceridine (TRV130) is an FDA-approved G-protein-biased MOP agonist for acute pain that shows reduced respiratory depression vs. morphine in clinical studies. Naloxone (antagonist) and naltrexone are approved for overdose reversal and OUD. Cebranopadol (MOP/NOP dual agonist) showed positive Phase 3 results for diabetic neuropathy pain in 2025. For peptide research, the tractable recipes are: endomorphin analogs with Aib substitution at Pro² for metabolic stability while preserving high-affinity MOP engagement; cyclic dermorphin analogs (dermorphin is the most potent naturally occurring MOP peptide, Ki ~0.6 nM) with N-methylated backbone for blood-brain barrier penetration; MOP/DOP bivalent peptides using TIPP-based DOP pharmacophore linked to endomorphin via variable-length PEG spacers for tolerance-resistant analgesia; and β-arrestin-biased MOP inverse agonists as mechanistic probes to resolve the controversy over which pathway mediates respiratory depression.
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE · 31 aa · @peptidemodel
| # | id | title | author | status | refs | IC50 | ♥ |
|---|---|---|---|---|---|---|---|
| 1 | pep-10704 | Dynorphin A: natural opioid pain and stress signal (porcine form) | pe@peptidemodel | 13 | — | 0 | |
| 2 | pep-10702 | Natural opioid brain peptide (Dynorphin A 1-13) | pe@peptidemodel | 10 | — | 0 | |
| 3 | pep-10700 | Dynorphin A (1-10) amide: natural opioid fragment that boosts morphine pain relief | pe@peptidemodel | 9 | — | 0 | |
| 4 | pep-10699 | Dynorphin A (1-8): natural pain-signaling brain peptide | pe@peptidemodel | 8 | — | 0 | |
| 5 | pep-10705 | Brain pain-relief peptide, extended form (Met-enkephalin + arginine) | pe@peptidemodel | 7 | — | 0 | |
| 6 | pep-10714 | Gliadorphin: wheat gluten fragment linked to autism and schizophrenia | pe@peptidemodel | 5 | — | 0 | |
| 7 | pep-10694 | Dermorphin: ultra-potent natural opioid from tree-frog skin | pe@peptidemodel | 5 | — | 0 | |
| 8 | pep-04445 | Beta-endorphin: the brain's own natural painkiller | pe@peptidemodel | 1 | — | 0 | |
| 9 | pep-10535 | Nociceptin: brain peptide that shapes pain, stress, and mood (Orphanin FQ) | pe@peptidemodel | 3 | — | 0 | |
| 10 | pep-10534 | Nociceptin (1-13) amide: lab fragment of a natural pain-signal peptide | pe@peptidemodel | 3 | — | 0 | |
| 11 | pep-10695 | Frog-skin painkiller peptide (D-Met2-Deltorphin) | pe@peptidemodel | 2 | — | 0 | |
| 12 | pep-10693 | Frog-skin opioid peptide (Deltorphin 1) | pe@peptidemodel | 2 | — | 0 | |
| 13 | pep-10611 | 26RFa brain-signaling peptide | pe@peptidemodel | 1 | — | 0 | |
| 14 | pep-10550 | Brain-signaling neuropeptide that activates an orphan receptor (P52 peptide) | pe@peptidemodel | 1 | — | 0 | |
| 15 | pep-10425 | Pain-blocking opioid research peptide (CHEMBL1927270) | pe@peptidemodel | 5 | — | 0 | |
| 16 | pep-10434 | Morphine-receptor-binding research peptide (CYRTT / CHEMBL1795717) | pe@peptidemodel | 4 | — | 0 | |
| 17 | pep-10706 | Painkiller-pathway research peptide (Pro3-Dynorphin A 1-11 amide) | pe@peptidemodel | 7 | — | 0 | |
| 18 | pep-10428 | Pain-relieving peptide (CHEMBL216640) | pe@peptidemodel | 2 | — | 0 | |
| 19 | pep-10426 | Dynorphin A look-alike: brain's own painkiller peptide (CHEMBL2028997) | pe@peptidemodel | 2 | — | 0 | |
| 20 | pep-10309 | Dual opioid & hunger-signal research peptide (YGDF / CHEMBL206974) | pe@peptidemodel | 2 | — | 0 |
No discussion threads yet.