pe
pep-04445 v1 CC-BY-SA-4.0

Beta-endorphin: the brain's own natural painkiller

A natural pain-relieving hormone made in the brain and pituitary gland; it eases pain and lifts mood by acting on the same receptors as morphine. Not a drug, a molecule every person naturally produces.

statusbioassayed targetOPRM1 length31 aa refs1
endogenous
status 2 / 5 · 0 verified on platform
prediction metrics boltz-2 1.0
ipTM0.885
pTM0.879
avg pLDDT77.8
ranking score0.799
STRUCTURE · PEP-04445 × OPRM1
ranking0.799
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence31 aa
15101520253031
YGGFMTSEKSQTPLVT LFKNAIIKNAYKKGE
overview readme

What this is

Beta-endorphin is one of the body's own natural painkillers — a 31-amino acid opioid peptide produced in the brain and pituitary gland. It is made from a larger precursor protein called proopiomelanocortin (POMC), the same precursor that also gives rise to ACTH (/card/pep-04440), α-MSH (/card/pep-10664), and several other hormones. When released, β-endorphin binds to the μ-opioid receptor (OPRM1) — the same receptor family that morphine acts on — and produces analgesic and mood-altering effects. It is not a synthetic drug; it is an endogenous signalling molecule that every person produces.

What it does

Beta-endorphin acts as a pain-suppressing and stress-modulating signal. By binding OPRM1, it dampens pain signalling in the brain, spinal cord, and periphery. It also plays a neuroendocrine role: β-endorphin-expressing neurons in the hypothalamic arcuate nucleus send projections to the supraoptic nucleus, and their expression changes during pregnancy and parturition (Douglas and colleagues, J Neuroendocrinol 2002, cited in Meddle and colleagues, J Neuroendocrinol 2014). Because β-endorphin and α-MSH are co-expressed in the same hypothalamic POMC neurons — the first neurons to appear in the developing primate hypothalamus — their signalling roles are intertwined from early in development (Rønnekleiv and colleagues, eNeuro 2025).

Mechanism

Beta-endorphin is generated from POMC through sequential proteolytic cleavage. The enzyme prohormone convertase 2 (PC2) is required for the final processing step that produces the active 31-residue form, β-endorphin₁₋₃₁. In mice lacking PC2, β-endorphin₁₋₃₁ accumulates to approximately five-fold higher levels in the pituitary and three-fold higher in the hypothalamus compared with wild-type controls, measured by radioimmunoassay (J Neurochem 2003). Once generated, β-endorphin may be released quickly after biosynthesis, or it may transiently serve as a precursor in the formation of Met-enkephalin (/card/pep-04455) (Neuropeptides 1986). Mass spectrometry studies of pituitary tissue have identified shorter N-terminally acetylated POMC-derived fragments co-released alongside β-endorphin₁₋₃₁, including Ac-γ-endorphin (the 1–27 fragment, Ac-YGGFMTSEKSQTPLVTLFKNAII) and a 1–28 acetylated form (J Mass Spectrometry 2006); these acetylated variants are not represented in the stored 31-residue raw sequence.

Evidence

  • Human: Beta-endorphin is an established endogenous hormone with well-characterized neuroendocrine roles in humans; it is not an investigational compound and is not in active clinical development as an exogenous drug candidate.
  • Animal: PC2-null mouse studies confirm the role of the PC2 convertase in generating β-endorphin₁₋₃₁ from POMC, with approximately five-fold and three-fold accumulation in pituitary and hypothalamus respectively compared with wild-type (J Neurochem 2003). Hypothalamic β-endorphin neuron projections and their changes during pregnancy and parturition have been characterized in rodents (Douglas and colleagues, J Neuroendocrinol 2002). POMC neuron development — including β-endorphin/α-MSH-expressing cells appearing first in the lateral basal hypothalamus at embryonic day 32–34 and migrating to the medial basal hypothalamus by day 45 — has been documented in fetal rhesus macaques, a model considered closely representative of human neurodevelopment (Rønnekleiv and colleagues, eNeuro 2025).
  • In vitro: Biosynthesis studies have tracked β-endorphin production and its relationship to Met-enkephalin precursor pathways in isolated cell preparations (Neuropeptides 1986).

Known effects

  • Pain modulation — endogenous analgesic role established via OPRM1 pharmacology
  • Neuroendocrine modulation — arcuate nucleus neurons project to supraoptic nucleus; expression changes during pregnancy and parturition (Douglas and colleagues, J Neuroendocrinol 2002)
  • Co-regulation with α-MSH — β-endorphin and α-MSH are produced from the same POMC neurons, with coordinated developmental onset in the primate hypothalamus (Rønnekleiv and colleagues, eNeuro 2025)
  • Acetylated fragment generation — Ac-γ-endorphin and related N-terminally acetylated shorter forms are co-released as distinct POMC-derived products in certain tissues (J Mass Spectrometry 2006)

Related peptides

  • α-MSH — co-produced from POMC in the same hypothalamic POMC neurons; melanocortin receptor agonist
  • Met-enkephalin — shorter endogenous opioid pentapeptide (YGGFM); shares the Tyr-Gly-Gly-Phe N-terminal opioid message sequence
  • ACTH — co-produced from POMC; adrenocortical-stimulating hormone from the same precursor gene
Hypotheses5 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-11

Could the same brain cell that controls pain also hold a key to stress eating and metabolism?

If true, it could mean one therapeutic approach for people who struggle with both chronic pain and weight gain caused by stress, instead of treating each separately.

The hypothesis
Beta-endorphin or its stable analogs could be repurposed for stress-related metabolic disorders by leveraging its co-expression with alpha-MSH in hypothalamic POMC neurons to simultaneously modulate both the hypothalamic-pituitary-adrenal axis and melanocortin-regulated energy homeostasis.
Why it’s plausible
POMC neurons co-produce beta-endorphin and alpha-MSH, and both are released in response to stress. While alpha-MSH is well known for its anorexigenic and metabolic effects via MC4R, beta-endorphin's concurrent release may serve to counterbalance or fine-tune the stress-metabolism axis. The two peptides are not independent products but co-released from the same vesicles.
Why it matters
If beta-endorphin acts as a functional brake on alpha-MSH-driven metabolic stress responses, modulating its signaling could provide a unified therapeutic angle for comorbid chronic pain, obesity, and anxiety disorders.
Plausibility.60
Novelty.60
Impact.60
Basis · grounding1 paper · 1 computed/note
[1]
paper
POMC neurons co-express beta-endorphin and alpha-MSH, and are the first neurons to appear in the developing primate hypothalamus.
doi: 10.1523/eneuro.0087-25.2025
[2]
noteBeta-endorphin and alpha-MSH are co-expressed in the same hypothalamic POMC neurons, and their signaling roles are intertwined from early in development.
openupdated 2026-06-11

Could the brain's natural painkiller also guide the development of hunger-regulating neurons?

If true, it could explain why early-life stress or metabolic changes in pregnancy affect appetite and mood later in life. It might open new ways to protect fetal brain development.

The hypothesis
Beta-endorphin co-released with alpha-MSH from hypothalamic POMC neurons acts as a developmental switch that shapes the later emergence of NPY circuits in the fetal hypothalamus, rather than merely functioning as a pain signal during gestation.
Why it’s plausible
POMC neurons are the first to appear in the developing primate hypothalamus, and NPY neurons emerge later. The temporal gap suggests beta-endorphin signaling during early development could influence the subsequent wiring or differentiation of NPY-expressing circuits, extending its role beyond acute analgesia into neurodevelopmental patterning.
Why it matters
If true, this would mean beta-endorphin has a previously unappreciated role in hypothalamic circuit assembly, with implications for how early-life stress or endocrine disruption might alter appetite, stress, and pain processing long-term.
Plausibility.50
Novelty.70
Impact.60
Basis · grounding1 paper
[1]
paper
POMC (beta-End and alphaMSH)-expressing neurons appear earlier in fetal rhesus monkey hypothalamus than NPY neurons, which are first detectable at day 44 of gestation.
doi: 10.1523/eneuro.0087-25.2025
openupdated 2026-06-11

Could this natural pain peptide work through a receptor team instead of a single target?

If true, future pain drugs might need to target the whole complex, not just one receptor. That could explain why synthetic opioids feel different from the body's own pain relief.

The hypothesis
The high but imperfect Boltz-2 interface confidence (ipTM=0.885) with OPRM1 may reflect a physiologically relevant interaction with an OPRM1 heterodimer or accessory protein complex that is absent in the prediction, rather than a simple monomeric receptor interaction, which would mean the annotated target is incomplete.
Why it’s plausible
ipTM scores above 0.8 typically indicate a genuine interaction, yet 0.885 is not in the highest confidence tier. Beta-endorphin is known to produce effects that differ qualitatively from synthetic mu-agonists, which could arise from engagement of receptor complexes rather than the monomeric receptor. The pLDDT of 77.8 suggests reasonable but not exceptional structural confidence, consistent with a dynamic or multicomponent interface.
Why it matters
If beta-endorphin signals through receptor complexes rather than OPRM1 alone, drug development strategies that target only the monomeric receptor may miss the full therapeutic profile or side-effect spectrum of endogenous signaling.
Plausibility.50
Novelty.60
Impact.60
Basis · grounding1 computed/note
[1]
structureBoltz-2 complex prediction: ipTM=0.8854526877403259, pLDDT=77.8 with OPRM1. High but not maximal confidence suggests possible missing interaction partners.
openupdated 2026-06-11

Could the back half of this natural painkiller decide which brain receptor it activates?

If true, it could explain why natural beta-endorphin feels different from morphine. It might help design new pain drugs with fewer side effects by tweaking that tail.

The hypothesis
The C-terminal region of beta-endorphin (residues 20-31, containing the NAYKKGE motif) contributes to receptor subtype selectivity beyond the well-characterized N-terminal YGGF opioid motif, potentially enabling differential signaling at delta or kappa opioid receptors despite the primary OPRM1 annotation.
Why it’s plausible
The N-terminal YGGF motif is established as the core opioid pharmacophore, but the C-terminal tail is highly conserved and structurally distinct across endogenous opioid peptides. The NAYKKGE sequence contains basic residues that could engage secondary receptor interfaces or influence G-protein coupling bias.
Why it matters
If the C-terminus modulates receptor selectivity, it could explain why beta-endorphin produces qualitatively different physiological effects than synthetic mu-agonists, and provide a rational basis for engineering peptide analogs with altered receptor profiles.
Plausibility.60
Novelty.40
Impact.60
Basis · grounding2 computed/notes
[1]
sequenceSequence YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE contains the conserved N-terminal YGGF opioid motif and a C-terminal NAYKKGE tail with multiple basic residues.
[2]
structureBoltz-2 complex prediction shows ipTM=0.885 and pLDDT=77.8 with OPRM1, indicating a confident but not perfect model that leaves room for unmodeled interactions.
openupdated 2026-06-11

Could we design a pain drug that only turns on in specific tissues, using the same enzyme that naturally creates beta-endorphin?

If true, it could lead to pain medications that only activate in the right place, reducing the risk of addiction and overdose that comes with current opioids.

The hypothesis
The prohormone convertase 2 (PC2) cleavage site that liberates beta-endorphin from POMC could be exploited as a conditional activation mechanism for engineered peptide prodrugs, where tissue-specific protease expression controls drug release.
Why it’s plausible
Beta-endorphin requires PC2 for its final maturation from POMC. PC2 expression is restricted to neuroendocrine tissues and certain pathological states. This endogenous processing logic could be reverse-engineered to create beta-endorphin prodrugs that are activated only in PC2-expressing tissues, such as pituitary tumors or neuroendocrine lesions.
Why it matters
If the PC2 cleavage mechanism can be co-opted for conditional drug activation, it would provide a built-in targeting strategy for peptide therapeutics that avoids systemic opioid exposure.
Plausibility.40
Novelty.70
Impact.50
Basis · grounding1 computed/note
[1]
noteBeta-endorphin is generated from POMC through sequential proteolytic cleavage, and PC2 is required for the final processing step.
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.8854526877403259 boltz-2
ranking score 0.7994133830070496 boltz-2
▸structural qualityopenfold3
metricvaluenote
gpde0.691global PDE — lower = better
disorderNaNfraction disordered
▸3-letter notation
Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu
▸recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights—
hardwarenvidia_nim_api
mlx version—
python—
random seed—
msa strategynone
diffusion samples1
runtime—
predicted bymlx@peptide
predicted at2026-04-24
▸citationbibtex
peptidemodel (2026). Beta-endorphin: the brain's own natural painkiller (pep-04445, v1). PeptideModel. https://peptidemodel.com/card/pep-04445
@peptide{pep04445,
  sequence = {YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE},
  target   = {oprm1},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
clinical trials 484 on ct.gov · 1 on EUCTR · checked 2026-05-22
ct.gov trials 484
with results 118
EUCTR 1
PubMed RCT 92
by phase
2phase 13phase 21phase 35no phase
by status
7completed2recruiting1unknown
references 1 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use