Beta-endorphin: the brain's own natural painkiller
A natural pain-relieving hormone made in the brain and pituitary gland; it eases pain and lifts mood by acting on the same receptors as morphine. Not a drug, a molecule every person naturally produces.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
Endogenous peptide — produced naturally and routinely synthesized for research
Fork this card to add platform evidence →
Endogenous peptide — receptor binding and activity established in published literature
Fork this card to add platform evidence →
What this is
Beta-endorphin is one of the body's own natural painkillers — a 31-amino acid opioid peptide produced in the brain and pituitary gland. It is made from a larger precursor protein called proopiomelanocortin (POMC), the same precursor that also gives rise to ACTH (/card/pep-04440), α-MSH (/card/pep-10664), and several other hormones. When released, β-endorphin binds to the μ-opioid receptor (OPRM1) — the same receptor family that morphine acts on — and produces analgesic and mood-altering effects. It is not a synthetic drug; it is an endogenous signalling molecule that every person produces.
What it does
Beta-endorphin acts as a pain-suppressing and stress-modulating signal. By binding OPRM1, it dampens pain signalling in the brain, spinal cord, and periphery. It also plays a neuroendocrine role: β-endorphin-expressing neurons in the hypothalamic arcuate nucleus send projections to the supraoptic nucleus, and their expression changes during pregnancy and parturition (Douglas and colleagues, J Neuroendocrinol 2002, cited in Meddle and colleagues, J Neuroendocrinol 2014). Because β-endorphin and α-MSH are co-expressed in the same hypothalamic POMC neurons — the first neurons to appear in the developing primate hypothalamus — their signalling roles are intertwined from early in development (Rønnekleiv and colleagues, eNeuro 2025).
Mechanism
Beta-endorphin is generated from POMC through sequential proteolytic cleavage. The enzyme prohormone convertase 2 (PC2) is required for the final processing step that produces the active 31-residue form, β-endorphin₁₋₃₁. In mice lacking PC2, β-endorphin₁₋₃₁ accumulates to approximately five-fold higher levels in the pituitary and three-fold higher in the hypothalamus compared with wild-type controls, measured by radioimmunoassay (J Neurochem 2003). Once generated, β-endorphin may be released quickly after biosynthesis, or it may transiently serve as a precursor in the formation of Met-enkephalin (/card/pep-04455) (Neuropeptides 1986). Mass spectrometry studies of pituitary tissue have identified shorter N-terminally acetylated POMC-derived fragments co-released alongside β-endorphin₁₋₃₁, including Ac-γ-endorphin (the 1–27 fragment, Ac-YGGFMTSEKSQTPLVTLFKNAII) and a 1–28 acetylated form (J Mass Spectrometry 2006); these acetylated variants are not represented in the stored 31-residue raw sequence.
Evidence
- Human: Beta-endorphin is an established endogenous hormone with well-characterized neuroendocrine roles in humans; it is not an investigational compound and is not in active clinical development as an exogenous drug candidate.
- Animal: PC2-null mouse studies confirm the role of the PC2 convertase in generating β-endorphin₁₋₃₁ from POMC, with approximately five-fold and three-fold accumulation in pituitary and hypothalamus respectively compared with wild-type (J Neurochem 2003). Hypothalamic β-endorphin neuron projections and their changes during pregnancy and parturition have been characterized in rodents (Douglas and colleagues, J Neuroendocrinol 2002). POMC neuron development — including β-endorphin/α-MSH-expressing cells appearing first in the lateral basal hypothalamus at embryonic day 32–34 and migrating to the medial basal hypothalamus by day 45 — has been documented in fetal rhesus macaques, a model considered closely representative of human neurodevelopment (Rønnekleiv and colleagues, eNeuro 2025).
- In vitro: Biosynthesis studies have tracked β-endorphin production and its relationship to Met-enkephalin precursor pathways in isolated cell preparations (Neuropeptides 1986).
Known effects
- Pain modulation — endogenous analgesic role established via OPRM1 pharmacology
- Neuroendocrine modulation — arcuate nucleus neurons project to supraoptic nucleus; expression changes during pregnancy and parturition (Douglas and colleagues, J Neuroendocrinol 2002)
- Co-regulation with α-MSH — β-endorphin and α-MSH are produced from the same POMC neurons, with coordinated developmental onset in the primate hypothalamus (Rønnekleiv and colleagues, eNeuro 2025)
- Acetylated fragment generation — Ac-γ-endorphin and related N-terminally acetylated shorter forms are co-released as distinct POMC-derived products in certain tissues (J Mass Spectrometry 2006)
Related peptides
- α-MSH — co-produced from POMC in the same hypothalamic POMC neurons; melanocortin receptor agonist
- Met-enkephalin — shorter endogenous opioid pentapeptide (YGGFM); shares the Tyr-Gly-Gly-Phe N-terminal opioid message sequence
- ACTH — co-produced from POMC; adrenocortical-stimulating hormone from the same precursor gene
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could the same brain cell that controls pain also hold a key to stress eating and metabolism?
If true, it could mean one therapeutic approach for people who struggle with both chronic pain and weight gain caused by stress, instead of treating each separately.
Could the brain's natural painkiller also guide the development of hunger-regulating neurons?
If true, it could explain why early-life stress or metabolic changes in pregnancy affect appetite and mood later in life. It might open new ways to protect fetal brain development.
Could this natural pain peptide work through a receptor team instead of a single target?
If true, future pain drugs might need to target the whole complex, not just one receptor. That could explain why synthetic opioids feel different from the body's own pain relief.
Could the back half of this natural painkiller decide which brain receptor it activates?
If true, it could explain why natural beta-endorphin feels different from morphine. It might help design new pain drugs with fewer side effects by tweaking that tail.
Could we design a pain drug that only turns on in specific tissues, using the same enzyme that naturally creates beta-endorphin?
If true, it could lead to pain medications that only activate in the right place, reducing the risk of addiction and overdose that comes with current opioids.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.8854526877403259 | boltz-2 |
| ranking score | 0.7994133830070496 | boltz-2 |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.691 | global PDE — lower = better |
| disorder | NaN | fraction disordered |
▸3-letter notation
▸recipeboltz-2 1.0
| parameter | value |
|---|---|
| model | boltz-2 1.0 |
| weights | — |
| hardware | nvidia_nim_api |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | none |
| diffusion samples | 1 |
| runtime | — |
| predicted by | mlx@peptide |
| predicted at | 2026-04-24 |
▸citationbibtex
@peptide{pep04445,
sequence = {YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE},
target = {oprm1},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}