Orexin-A: the brain's 'stay awake' signal (Hypocretin-1)
A natural brain peptide that keeps you awake and alert; its loss causes narcolepsy type 1, a condition of sudden uncontrollable sleepiness. Used as a research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
Orexin-A (also called hypocretin-1) is a 33-amino-acid brain peptide made by a small cluster of neurons in the lateral hypothalamus. It is the body's main "stay awake" signal: when these neurons are destroyed by an autoimmune process, the result is narcolepsy type 1, the disorder defined by sudden uncontrollable sleepiness and cataplexy. The peptide carries two intramolecular disulfide bonds that hold it in the shape required to engage its two receptors (OX1R and OX2R); those bonds are essential for activity and are not represented in the raw 33-letter sequence shown on this card.
Interest in orexin-A as a drug has centered on replacing the lost signal in narcolepsy type 1. Because the peptide does not cross the blood-brain barrier well, the small human studies that have been done used intranasal delivery, which reaches the brain via the olfactory and trigeminal pathways. The broader clinical field has now shifted toward oral small-molecule OX2R-selective agonists, which have shown strong Phase 2 results in narcolepsy type 1 (Dauvilliers et al., NEJM 2025).
History
Orexin-A was discovered twice in the same few weeks of early 1998 by two independent groups working on different questions. At The Scripps Research Institute, de Lecea, Sutcliffe and colleagues used a subtractive-hybridization screen for hypothalamus-specific transcripts and named the resulting peptides "hypocretins" — for their hypothalamic origin and their distant structural relationship to the gut hormone secretin (de Lecea et al., PNAS 1998). At UT Southwestern, Sakurai, Yanagisawa and colleagues identified the same molecules as the natural ligands of two orphan G-protein-coupled receptors and named them "orexins" — from the Greek for appetite — after observing that intracerebroventricular injection stimulated feeding in rats (Sakurai et al., Cell 1998). Both names are still in routine use today.
The link to narcolepsy was made two years later. Nishino, Mignot and colleagues showed that cerebrospinal-fluid hypocretin-1 (orexin-A) was undetectable in most narcolepsy patients (Nishino et al., Lancet 2000), and Peyron and colleagues documented a generalized loss of hypocretin peptides — and a rare causative gene mutation — in postmortem narcoleptic brains (Peyron et al., Nature Medicine 2000). Together those papers redefined narcolepsy type 1 as an orexin-deficiency disorder and turned the orexin system into a major target for both sleep-promoting and wake-promoting drugs.
What it does
Orexin-A behaves as the brain's general arousal signal. It activates several upstream wakefulness systems at once — the noradrenergic locus coeruleus, the histaminergic tuberomammillary nucleus, the serotonergic raphe nuclei, and the dopaminergic ventral tegmental area — and also touches the hypothalamic-pituitary-adrenal axis, sympathetic outflow, and energy metabolism (Sakurai et al., Cell 1998; de Lecea et al., PNAS 1998). When the orexin neurons are destroyed, these arousal systems lose their main coordinating input; the clinical result is the excessive daytime sleepiness, fragmented night sleep, and cataplexy that define narcolepsy type 1 (Nishino et al., Lancet 2000; Peyron et al., Nature Medicine 2000).
Evidence
- Human: Small acute intranasal studies in narcolepsy type 1 patients have reported biologically interesting effects — improved sleep architecture and reduced direct wake-to-REM transitions (Baier et al., Sleep Medicine 2011), improved sleepiness and attention measures (Weinhold et al., Behavioural Brain Research 2014), and partial restoration of olfactory function (Baier et al., Brain 2008). A separate pilot in healthy males showed that intranasal orexin-A acutely raised resting muscle sympathetic nerve activity without changing blood pressure or heart rate (Schwarz et al., Journal of Neurophysiology 2022). No long-term controlled trial of intranasal orexin-A as a replacement therapy has been completed. Clinical translation of orexin agonism has shifted to oral OX2R-selective small molecules, where oveporexton (TAK-861) significantly improved wakefulness, sleepiness and cataplexy measures over 8 weeks in Phase 2 in narcolepsy type 1 (Dauvilliers et al., NEJM 2025).
- Animal: Foundational rodent work characterized orexin-A's role in arousal, feeding, and sleep-wake control (Sakurai et al., Cell 1998).
- In vitro: Orexin-A binds and activates both OX1R and OX2R as G-protein-coupled receptors; this was established at the receptor-binding and signaling level in the original discovery paper (Sakurai et al., Cell 1998).
Mechanism
Orexin-A is a dual agonist at OX1R and OX2R, two closely related GPCRs whose expression is concentrated in arousal-regulating brainstem and hypothalamic nuclei (Sakurai et al., Cell 1998). OX2R is particularly important for sleep-wake control, which is why OX2R-selective small-molecule agonists are now the dominant clinical-development direction (Dauvilliers et al., NEJM 2025). The two intramolecular disulfide bonds in orexin-A are not visible in the raw 33-letter sequence but are required for the peptide to adopt the conformation that activates its receptors; orexin-B lacks this disulfide architecture and has a much shorter biological half-life and a different receptor-selectivity profile (Sakurai et al., Cell 1998).
Narcolepsy type 1 reflects a near-total loss of the lateral-hypothalamic orexin neurons, with the corresponding collapse of cerebrospinal-fluid orexin-A to essentially undetectable levels (Nishino et al., Lancet 2000; Peyron et al., Nature Medicine 2000). That is the pathophysiological basis for orexin-replacement strategies. Systemic (subcutaneous, intravenous) administration is not expected to reproduce the central wakefulness effects because the peptide does not cross the blood-brain barrier well; intranasal delivery exploits olfactory and trigeminal pathways to reach the central nervous system, which is why the small human studies all used the intranasal route (Baier et al., Brain 2008; Baier et al., Sleep Medicine 2011; Weinhold et al., Behavioural Brain Research 2014).
Known effects
- Acute wakefulness, attention, and sleep-architecture effects in narcolepsy type 1 — small controlled intranasal studies (Baier et al., Sleep Medicine 2011; Weinhold et al., Behavioural Brain Research 2014).
- Acute restoration of olfactory function in narcolepsy type 1 — single controlled intranasal study (Baier et al., Brain 2008).
- Acute sympathetic vascular activation in healthy adults — pilot study; increase in resting muscle sympathetic nerve activity without change in blood pressure or heart rate (Schwarz et al., Journal of Neurophysiology 2022).
- Wakefulness promotion in healthy adults — not established; no rigorous clinical evidence supports cognitive or wakefulness benefit in non-deficient individuals.
Safety signals
Human safety data for exogenous orexin-A is limited to small acute studies; there is no long-term controlled exposure data. The most consistent acute signal is sympathetic activation: intranasal orexin-A in healthy males significantly raised resting muscle sympathetic nerve activity in a pilot study, although blood pressure and heart rate were unchanged at that dose and time point (Schwarz et al., Journal of Neurophysiology 2022). Mechanistically, orexin signaling drives sympathetic outflow and cardiovascular arousal, so chronic-exposure cardiovascular safety remains an open question (Sakurai et al., Cell 1998).
Combining orexin-A with a dual orexin receptor antagonist (suvorexant, lemborexant, or daridorexant) would be pharmacologically self-defeating — those drugs are designed to block exactly the receptors orexin-A activates. No reproductive, pediatric, or pregnancy data exist for exogenous orexin-A.
Regulatory status
- US (FDA): Not approved for any indication. Not a controlled substance. Sold by research-chemical suppliers; not authorized for human therapeutic use.
- EU (EMA), UK (MHRA), Australia (TGA), Japan (PMDA), Canada (Health Canada): Not approved.
- WADA: Not explicitly named on the Prohibited List. Because orexin-A is not approved for human therapeutic use anywhere, the S0 "non-approved substances" clause is plausibly applicable; athletes should treat it as prohibited absent specific guidance.
- Context: Dual orexin receptor antagonists (suvorexant, lemborexant, daridorexant) — which act in the pharmacologically opposite direction — are FDA-approved for insomnia. Oral OX2R-selective small-molecule agonists, most prominently oveporexton (TAK-861), have shown positive Phase 2 results in narcolepsy type 1 (Dauvilliers et al., NEJM 2025) but had not received regulatory approval as of writing.
Related peptides
- Orexin-B (hypocretin-2) — the sister peptide from the same prepro-orexin precursor; shorter, lacks the disulfide architecture of orexin-A, and is more selective for OX2R (Sakurai et al., Cell 1998).
- Suvorexant, lemborexant, daridorexant — small-molecule dual orexin receptor antagonists, approved for insomnia, that act in the pharmacologically opposite direction to orexin-A.
- Oveporexton (TAK-861) — oral OX2R-selective small-molecule agonist in clinical development for narcolepsy type 1 (Dauvilliers et al., NEJM 2025); the leading non-peptide approach to restoring orexin signaling.
Open questions
- Long-term intranasal orexin-A as replacement therapy in narcolepsy type 1. Only acute single-dose human studies have been reported; no controlled chronic trial has been completed.
- Head-to-head positioning against oral OX2R agonists. As oveporexton and other oral OX2R-selective agents advance through late-stage trials, it is unclear whether intranasal peptide replacement retains a clinical niche.
- Cardiovascular safety with chronic exposure. Acute sympathetic activation has been documented (Schwarz et al., Journal of Neurophysiology 2022); chronic-dose data do not exist.
- Effects in narcolepsy type 2, idiopathic hypersomnia, and healthy adults. Available human data are dominated by narcolepsy type 1, where the orexin system is depleted; whether augmenting an intact orexin system is beneficial or harmful is not established.
- Reproductive, pediatric, and pregnancy data. No human data in any of these populations.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Is the selective preference of orexin-A for one receptor over the other controlled by the compact, knotted part of the molecule rather than its long spiral tail?
Knowing which part of orexin-A drives receptor selectivity would let researchers build versions that activate only the sleep-promoting receptor without activating the anxiety or addiction-related receptor, making safer treatments for narcolepsy and potentially for other conditions like depression and addiction.
Does a flexible bend in the middle of orexin-A control how tightly and how long it grabs its receptor?
Drugs that stay attached to their receptor longer often need to be taken less frequently and work better at lower doses. If scientists can stiffen or tune this hinge region, they could engineer intranasal orexin-A replacements that remain effective for hours rather than minutes, making treatment of narcolepsy much more practical.
Is the weak computer prediction for orexin-A just an artifact of the software ignoring its essential internal crosslinks?
Correctly interpreting structure predictions prevents researchers from chasing false leads about orexin-A's target. Knowing the low score is a technical artifact, not a biology signal, saves time and guides investment toward the correct receptor biology.
Does the inconsistency in nasal orexin-A studies simply reflect that some participants had damaged nasal passages that blocked the drug from reaching the brain?
If a routine smell test can identify who will absorb intranasal orexin-A effectively, clinical trials could enroll only those patients, dramatically improving the chances of seeing a clear benefit. For narcolepsy patients, this would accelerate access to the first peptide-based treatment that replaces the signal their bodies are missing.
Could the same brain chemical people with narcolepsy are missing also explain why some of them have problems with slow digestion?
If orexin-A deficiency causes both the sleep disorder and digestive problems in narcolepsy patients, a single intranasal treatment could address both. This would meaningfully improve quality of life for people with narcolepsy, who currently have no way to replace the missing brain signal.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.5949061512947083 | openfold3-mlx |
| ranking score | 0.700474739074707 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.660 | global PDE — lower = better |
| disorder | 0.133 | fraction disordered |
| chain pair ipTM (A, B) | 0.595 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | — |
| hardware | — |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | — |
| diffusion samples | 1 |
| runtime | 99s |
| predicted by | mlx@peptide |
| predicted at | 2026-05-03 |
▸citationbibtex
@peptide{pep10914,
sequence = {RPLPDCCRQKTCSCRLYELLHGAGNHAAGILTM},
target = {ox2r},
author = {peptidemodel},
year = {2026},
status = {computed}
}