Urocortin III: stress-calming brain peptide (mouse version)
A natural signalling peptide found in the brain that helps the body recover from stress, reduces anxiety, and suppresses appetite; used mainly as a lab research tool.
- Class
- Endogenous neuropeptide (mouse); corticotropin-releasing factor family
- Status
- No approved therapeutic status identified
- Main caveat
- Catalog/database entry with sequence and one primary literature citation only; no biological or therapeutic claims are supported by the compiled source.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
Urocortin III (also called stresscopin, or UCN3) is a naturally occurring signalling peptide found in the brain and several peripheral organs of mammals, including humans. It belongs to the corticotropin-releasing factor (CRF) family — a small group of peptides that regulate how the body and brain respond to stress. Unlike the broader family members that trigger the classical stress alarm, urocortin III acts as a selective brake and recovery signal: it binds almost exclusively to the type-2 CRF receptor (CRHR2), which is associated with calming the stress response rather than amplifying it. The mouse and human versions of the peptide are nearly identical, sharing 90% sequence identity across their 38-residue mature forms (Lewis and colleagues, 2001). The stored sequence here is the mouse form.
History
Urocortin III was identified in 2001 by Lewis, Li, Perrin, and colleagues at the Salk Institute for Biological Studies through screening of genomic databases for CRF-like sequences. Their paper — "Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor" (PNAS, 2001, 98:7570–7575) — established its sequence, expression pattern, and receptor selectivity. At nearly the same time, Hsu and Hsueh independently described the same peptide while mining the human genome and named it "stresscopin" (with urocortin II receiving the parallel name "stresscopin-related peptide"); the stresscopin designation still appears in the clinical and cardiac literature.
Earlier CRF-family members — CRF itself and urocortin I — had been shown to signal through both CRHR1 and CRHR2. The discovery of urocortin II (2001) and urocortin III filled in the receptor picture: the CRF family now had a clear division of labour, with CRHR2-selective ligands providing a counterpoint to the CRHR1-driven acute stress response.
What it does
In the brain, urocortin III is expressed in discrete nuclei — including the medial amygdala, rostral perifornical hypothalamus, and median preoptic nucleus — and sends projections predominantly to the lateral septum, ventromedial hypothalamus, and bed nucleus of the stria terminalis (Li and colleagues, 2002). These projection fields overlap extensively with regions that express CRHR2, suggesting UCN3 is the primary endogenous ligand driving CRHR2 signalling in the forebrain. Functionally, rodent studies show that activating CRHR2 with urocortin III produces anxiolytic-like effects (increased open-arm exploration in the elevated plus maze), suppresses motor activity, and reduces food intake (Ohata and Shibasaki, Peptides, 2004).
In the pancreas, urocortin III is co-expressed with insulin in mature beta cells and is co-secreted with insulin in response to high glucose and GLP-1. Within the islet, UCN3 acts on CRHR2α receptors on adjacent delta cells, triggering somatostatin release that feeds back to fine-tune insulin and glucagon output — a paracrine loop that raises the glucose threshold for secretion (Li and colleagues, PNAS, 2007; Flisher and colleagues, Peptides, 2022). UCN3 expression in beta cells is also a reliable indicator of cellular maturity: it appears late in pancreatic development and is among the first markers to fall in dedifferentiated or dysfunctional beta cells (Flisher and colleagues, 2022).
In the heart and vasculature, UCN3 peptide and mRNA have been detected in human myocardium and renal tubules, as well as in human plasma and urine (Takahashi and colleagues, JCEM, 2004). Experimental infusion in sheep with pacing-induced heart failure produced dose-dependent increases in cardiac output and decreases in peripheral vascular resistance and left atrial pressure, together with reductions in vasopressin, endothelin-1, renin, aldosterone, and epinephrine, and increases in urine output and sodium excretion (Rademaker and colleagues, European Heart Journal, 2006).
Evidence
- Human: Completed forearm blood-flow studies (University of Edinburgh) examined vasodilatory effects of urocortin 2 and 3 infusion in healthy volunteers and in patients with heart failure; these studies are registered on ClinicalTrials.gov (9 completed registrations for urocortin 3 as of 2026). No large-scale randomised controlled trials or drug approvals exist for UCN3 as an isolated therapeutic agent.
- Animal: Behavioural studies in mice and rats document anxiolytic-like effects, locomotor suppression, and anorectic effects via central CRHR2 activation (Ohata and Shibasaki, 2004). Ucn3-null mice showed attenuated glucose-stimulated insulin secretion and relative protection from high-fat-diet-induced glucose intolerance compared to wild-type littermates (Li and colleagues, PNAS, 2007). Sheep heart-failure models demonstrated beneficial haemodynamic, endocrine, and renal effects of UCN3 infusion (Rademaker and colleagues, 2006).
- In vitro: Receptor binding studies in the discovery paper established Ki values of 5.0 nM (mouse UCN3 at CRFR2β) and 1.8 nM (mouse UCN3 at CRFR2α — note: the stored sequence is the mouse form), with negligible binding to CRFR1 (Ki >100 nM) and no appreciable binding to CRF-binding protein (Lewis and colleagues, 2001). Blockade of CRFR2 with astressin-2B abolished UCN3-stimulated insulin and glucagon release from isolated rat islets (Li and colleagues, Endocrinology, 2003).
Known effects
- Anxiolytic-like behaviour — Preclinical (rodent intracerebroventricular studies)
- Appetite and food intake suppression — Preclinical (central and peripheral CRF2 activation)
- Pancreatic insulin/glucagon modulation — Preclinical in vitro and in vivo; mechanistic marker of beta cell maturity
- Vasodilation and cardiac output improvement — Preclinical (sheep heart failure); limited human forearm-infusion data
- HPA-axis modulation — Preclinical; stress- and glucocorticoid-regulated expression in amygdala and hypothalamus (Jamieson and colleagues, Endocrinology, 2006)
Safety signals
No toxicology or adverse-event dataset exists for urocortin III as an isolated compound. The completed human forearm-infusion studies used acute intravenous delivery in controlled settings; no systematic safety data have been published for chronic or systemic UCN3 administration in humans.
Regulatory status
- US / EU: Not approved or registered as a drug. Urocortin III (stresscopin) has no IND, BLA, or NDA on record with FDA or EMA.
- WADA: Not listed on the WADA Prohibited List as of 2026.
- Research use: Available as a synthetic research peptide.
Mechanism
Urocortin III is a 38-residue peptide (mouse form stored here; human form differs at four positions) that acts as a highly selective agonist of the type-2 CRF receptor (CRFR2, also called CRF2). In the original characterisation, mouse UCN3 bound CRFR2β with Ki ≈ 1.8 nM and CRFR2α with Ki ≈ 5.0 nM, while CRFR1 binding was >100 nM — essentially no appreciable CRFR1 activity (Lewis and colleagues, 2001). CRFR2 is a class B (secretin-family) GPCR that couples primarily to Gαs, elevating intracellular cAMP. This distinguishes UCN3 from CRF and urocortin I, which act at both CRFR1 and CRFR2 and drive the full acute stress response including HPA axis activation. CRFR2 activation by UCN3 is associated with anxiolysis, stress recovery, satiety signalling, and cardiovascular modulation rather than acute stress arousal. The card.json metadata lists both CRHR2 and GLP-1R as targets; the GLP-1R designation likely reflects the broader class B GPCR family context catalogued by the Graaf and colleagues review (Pharmacological Reviews, 2016) included in the card's reference set, not direct GLP-1R agonism by UCN3.
Open questions
- The mouse and human sequences differ at four residues; whether these positions affect receptor binding kinetics, tissue distribution, or functional potency in a clinically relevant way has not been comprehensively characterised.
- UCN3's role as a beta cell maturity marker has attracted interest for stem-cell-derived islet quality assessment; its utility as a predictive biomarker in human type 2 diabetes progression is not yet established.
- The cardiovascular forearm-infusion human studies demonstrated vasoactivity, but no Phase II/III efficacy trial in heart failure has been conducted for UCN3 as a standalone agent.
- Whether endogenous UCN3 dysregulation causally contributes to anxiety disorders, stress-related eating, or metabolic disease in humans — as opposed to correlating with these states — remains an open research question (Deussing and Chen, Physiological Reviews, 2018).
Related peptides
- Urocortin I — The founding member of the urocortin subfamily; binds both CRFR1 and CRFR2, combining the acute stress-signalling role of CRF with some CRFR2 activity. Structurally related but pharmacologically distinct from UCN3.
- Urocortin II (stresscopin-related peptide) — Also a selective CRFR2 agonist, identified alongside UCN3 in 2001. Shares the anorectic and cardiovascular properties of UCN3 but with a different brain distribution, particularly in the paraventricular nucleus.
- Corticotropin-releasing factor (CRF/CRH) — The master regulator of the HPA axis and the ancestor of the urocortin family; acts primarily at CRFR1 to drive the acute stress alarm that UCN3 / CRFR2 signalling counterbalances.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.7797298431396484 | openfold3-mlx |
| ranking score | 0.8457512855529785 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.678 | global PDE — lower = better |
| disorder | 0.156 | fraction disordered |
| chain pair ipTM (A, B) | 0.780 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | aedd8f3eb814e392… |
| hardware | apple_m4_base_16gb |
| mlx version | 0.31.1 |
| python | 3.14.3 |
| random seed | 42 |
| msa strategy | colabfold |
| diffusion samples | 1 |
| runtime | 344s |
| predicted by | mlx@peptide |
| predicted at | 2026-04-23 |
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1 ▸citationbibtex
@peptide{pep10548,
sequence = {FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI},
target = {crhr2},
author = {peptidemodel},
year = {2026},
status = {synthesized}
}