pe
pep-10548 v1 CC-BY-SA-4.0

Urocortin III: stress-calming brain peptide (mouse version)

A natural signalling peptide found in the brain that helps the body recover from stress, reduces anxiety, and suppresses appetite; used mainly as a lab research tool.

statussynthesized targetCRHR2 length38 aa refs2
snapshot sparse 10% confidence
Class
Endogenous neuropeptide (mouse); corticotropin-releasing factor family
Status
No approved therapeutic status identified
Main caveat
Catalog/database entry with sequence and one primary literature citation only; no biological or therapeutic claims are supported by the compiled source.
status 4 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.780
pTM0.720
avg pLDDT49.9
ranking score0.846
STRUCTURE · PEP-10548 × CRHR2
ranking0.846
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence38 aa
1510152025303538
FTLSLDVPTNIMNILFNID KAKNLRAKAAANAQLMAQI
in the news 263 articles
overview readme

What this is

Urocortin III (also called stresscopin, or UCN3) is a naturally occurring signalling peptide found in the brain and several peripheral organs of mammals, including humans. It belongs to the corticotropin-releasing factor (CRF) family — a small group of peptides that regulate how the body and brain respond to stress. Unlike the broader family members that trigger the classical stress alarm, urocortin III acts as a selective brake and recovery signal: it binds almost exclusively to the type-2 CRF receptor (CRHR2), which is associated with calming the stress response rather than amplifying it. The mouse and human versions of the peptide are nearly identical, sharing 90% sequence identity across their 38-residue mature forms (Lewis and colleagues, 2001). The stored sequence here is the mouse form.

History

Urocortin III was identified in 2001 by Lewis, Li, Perrin, and colleagues at the Salk Institute for Biological Studies through screening of genomic databases for CRF-like sequences. Their paper — "Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor" (PNAS, 2001, 98:7570–7575) — established its sequence, expression pattern, and receptor selectivity. At nearly the same time, Hsu and Hsueh independently described the same peptide while mining the human genome and named it "stresscopin" (with urocortin II receiving the parallel name "stresscopin-related peptide"); the stresscopin designation still appears in the clinical and cardiac literature.

Earlier CRF-family members — CRF itself and urocortin I — had been shown to signal through both CRHR1 and CRHR2. The discovery of urocortin II (2001) and urocortin III filled in the receptor picture: the CRF family now had a clear division of labour, with CRHR2-selective ligands providing a counterpoint to the CRHR1-driven acute stress response.

What it does

In the brain, urocortin III is expressed in discrete nuclei — including the medial amygdala, rostral perifornical hypothalamus, and median preoptic nucleus — and sends projections predominantly to the lateral septum, ventromedial hypothalamus, and bed nucleus of the stria terminalis (Li and colleagues, 2002). These projection fields overlap extensively with regions that express CRHR2, suggesting UCN3 is the primary endogenous ligand driving CRHR2 signalling in the forebrain. Functionally, rodent studies show that activating CRHR2 with urocortin III produces anxiolytic-like effects (increased open-arm exploration in the elevated plus maze), suppresses motor activity, and reduces food intake (Ohata and Shibasaki, Peptides, 2004).

In the pancreas, urocortin III is co-expressed with insulin in mature beta cells and is co-secreted with insulin in response to high glucose and GLP-1. Within the islet, UCN3 acts on CRHR2α receptors on adjacent delta cells, triggering somatostatin release that feeds back to fine-tune insulin and glucagon output — a paracrine loop that raises the glucose threshold for secretion (Li and colleagues, PNAS, 2007; Flisher and colleagues, Peptides, 2022). UCN3 expression in beta cells is also a reliable indicator of cellular maturity: it appears late in pancreatic development and is among the first markers to fall in dedifferentiated or dysfunctional beta cells (Flisher and colleagues, 2022).

In the heart and vasculature, UCN3 peptide and mRNA have been detected in human myocardium and renal tubules, as well as in human plasma and urine (Takahashi and colleagues, JCEM, 2004). Experimental infusion in sheep with pacing-induced heart failure produced dose-dependent increases in cardiac output and decreases in peripheral vascular resistance and left atrial pressure, together with reductions in vasopressin, endothelin-1, renin, aldosterone, and epinephrine, and increases in urine output and sodium excretion (Rademaker and colleagues, European Heart Journal, 2006).

Evidence

  • Human: Completed forearm blood-flow studies (University of Edinburgh) examined vasodilatory effects of urocortin 2 and 3 infusion in healthy volunteers and in patients with heart failure; these studies are registered on ClinicalTrials.gov (9 completed registrations for urocortin 3 as of 2026). No large-scale randomised controlled trials or drug approvals exist for UCN3 as an isolated therapeutic agent.
  • Animal: Behavioural studies in mice and rats document anxiolytic-like effects, locomotor suppression, and anorectic effects via central CRHR2 activation (Ohata and Shibasaki, 2004). Ucn3-null mice showed attenuated glucose-stimulated insulin secretion and relative protection from high-fat-diet-induced glucose intolerance compared to wild-type littermates (Li and colleagues, PNAS, 2007). Sheep heart-failure models demonstrated beneficial haemodynamic, endocrine, and renal effects of UCN3 infusion (Rademaker and colleagues, 2006).
  • In vitro: Receptor binding studies in the discovery paper established Ki values of 5.0 nM (mouse UCN3 at CRFR2β) and 1.8 nM (mouse UCN3 at CRFR2α — note: the stored sequence is the mouse form), with negligible binding to CRFR1 (Ki >100 nM) and no appreciable binding to CRF-binding protein (Lewis and colleagues, 2001). Blockade of CRFR2 with astressin-2B abolished UCN3-stimulated insulin and glucagon release from isolated rat islets (Li and colleagues, Endocrinology, 2003).

Known effects

  • Anxiolytic-like behaviour — Preclinical (rodent intracerebroventricular studies)
  • Appetite and food intake suppression — Preclinical (central and peripheral CRF2 activation)
  • Pancreatic insulin/glucagon modulation — Preclinical in vitro and in vivo; mechanistic marker of beta cell maturity
  • Vasodilation and cardiac output improvement — Preclinical (sheep heart failure); limited human forearm-infusion data
  • HPA-axis modulation — Preclinical; stress- and glucocorticoid-regulated expression in amygdala and hypothalamus (Jamieson and colleagues, Endocrinology, 2006)

Safety signals

No toxicology or adverse-event dataset exists for urocortin III as an isolated compound. The completed human forearm-infusion studies used acute intravenous delivery in controlled settings; no systematic safety data have been published for chronic or systemic UCN3 administration in humans.

Regulatory status

  • US / EU: Not approved or registered as a drug. Urocortin III (stresscopin) has no IND, BLA, or NDA on record with FDA or EMA.
  • WADA: Not listed on the WADA Prohibited List as of 2026.
  • Research use: Available as a synthetic research peptide.

Mechanism

Urocortin III is a 38-residue peptide (mouse form stored here; human form differs at four positions) that acts as a highly selective agonist of the type-2 CRF receptor (CRFR2, also called CRF2). In the original characterisation, mouse UCN3 bound CRFR2β with Ki ≈ 1.8 nM and CRFR2α with Ki ≈ 5.0 nM, while CRFR1 binding was >100 nM — essentially no appreciable CRFR1 activity (Lewis and colleagues, 2001). CRFR2 is a class B (secretin-family) GPCR that couples primarily to Gαs, elevating intracellular cAMP. This distinguishes UCN3 from CRF and urocortin I, which act at both CRFR1 and CRFR2 and drive the full acute stress response including HPA axis activation. CRFR2 activation by UCN3 is associated with anxiolysis, stress recovery, satiety signalling, and cardiovascular modulation rather than acute stress arousal. The card.json metadata lists both CRHR2 and GLP-1R as targets; the GLP-1R designation likely reflects the broader class B GPCR family context catalogued by the Graaf and colleagues review (Pharmacological Reviews, 2016) included in the card's reference set, not direct GLP-1R agonism by UCN3.

Open questions

  • The mouse and human sequences differ at four residues; whether these positions affect receptor binding kinetics, tissue distribution, or functional potency in a clinically relevant way has not been comprehensively characterised.
  • UCN3's role as a beta cell maturity marker has attracted interest for stem-cell-derived islet quality assessment; its utility as a predictive biomarker in human type 2 diabetes progression is not yet established.
  • The cardiovascular forearm-infusion human studies demonstrated vasoactivity, but no Phase II/III efficacy trial in heart failure has been conducted for UCN3 as a standalone agent.
  • Whether endogenous UCN3 dysregulation causally contributes to anxiety disorders, stress-related eating, or metabolic disease in humans — as opposed to correlating with these states — remains an open research question (Deussing and Chen, Physiological Reviews, 2018).

Related peptides

  • Urocortin I — The founding member of the urocortin subfamily; binds both CRFR1 and CRFR2, combining the acute stress-signalling role of CRF with some CRFR2 activity. Structurally related but pharmacologically distinct from UCN3.
  • Urocortin II (stresscopin-related peptide) — Also a selective CRFR2 agonist, identified alongside UCN3 in 2001. Shares the anorectic and cardiovascular properties of UCN3 but with a different brain distribution, particularly in the paraventricular nucleus.
  • Corticotropin-releasing factor (CRF/CRH) — The master regulator of the HPA axis and the ancestor of the urocortin family; acts primarily at CRFR1 to drive the acute stress alarm that UCN3 / CRFR2 signalling counterbalances.
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.7797298431396484 openfold3-mlx
ranking score 0.8457512855529785 openfold3-mlx
▸structural qualityopenfold3
0
metricvaluenote
gpde0.678global PDE — lower = better
disorder0.156fraction disordered
chain pair ipTM (A, B)0.780interface quality
▸3-letter notation
Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile
▸recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime344s
predicted bymlx@peptide
predicted at2026-04-23
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
▸citationbibtex
peptidemodel (2026). Urocortin III: stress-calming brain peptide (mouse version) (pep-10548, v1). PeptideModel. https://peptidemodel.com/card/pep-10548
@peptide{pep10548,
  sequence = {FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI},
  target   = {crhr2},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 2 by signal overlap
clinical trials 5 on ct.gov · checked 2026-05-09
ct.gov trials 5
by phase
5no phase
by status
4completed1unknown
references 2 papers
[1]
Retroviruses and the pathogenesis of schizophrenia
Lewis, D. Proceedings of the National Academy of Sciences 2001
evidence
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use