Prosomatostatin fragment (ProSS1-32): lab research tool

What this is

ProSS1-32 is the N-terminal 32-residue fragment of prosomatostatin — the intermediate precursor from which the hormone somatostatin is ultimately derived. It is generated when the larger prosomatostatin molecule is cleaved during processing into the bioactive somatostatin forms. Schmidt and colleagues first isolated and fully sequenced proSS1-32 from porcine upper intestine in 1985 (FEBS Letters), showing that its amino acid sequence is identical between pigs and humans. The fragment occupies the N-terminal half of prosomatostatin and does not itself contain the somatostatin-14 or somatostatin-28 sequences, which reside in the C-terminal portion of the precursor.

History

Somatostatin (SS-14) was originally isolated from sheep hypothalamus in 1973 by Brazeau and colleagues as a hypothalamic factor that inhibits the release of growth hormone from the pituitary. The longer form, somatostatin-28, was characterized around 1980, and the preprosomatostatin gene was cloned that same year, revealing the full precursor hierarchy: preprosomatostatin (116 residues) → prosomatostatin (92 residues after signal-peptide removal) → N-terminal and C-terminal cleavage products. ProSS1-32, the N-terminal fragment, was isolated and sequenced by Schmidt and colleagues in 1985 from porcine intestinal extracts, confirming the position of the primary cleavage site between residues 32 and 33.

What it does

ProSS1-32 is a biosynthetic intermediate rather than an established hormone in its own right. When prosomatostatin is cleaved at the Leu32–Leu33 bond, the C-terminal portion (residues 33–92) carries the somatostatin-28 and somatostatin-14 sequences that go on to exert the hormone's regulatory effects on growth hormone secretion, gastrointestinal function, and pancreatic hormone release. The N-terminal fragment (proSS1-32) does not contain those somatostatin sequences. Later work by Mouchantaf and colleagues (Regulatory Peptides, 2004) showed that the enzyme SKI-1, a membrane-bound subtilase, can further process the N-terminal prosomatostatin segment at an RXRXXL motif to generate smaller fragments including the decapeptide PSST[1-10] (also called antrin), which was identified in gastric D cells and portal blood. Whether proSS1-32 itself has direct biological activity at any receptor is not established in the published literature.

Evidence

• Human: No human studies of proSS1-32 specifically have been published. The broader prosomatostatin processing pathway is well characterized in humans through studies of preprosomatostatin gene structure and expression.
• Animal: ProSS1-32 was isolated and sequenced from porcine intestinal extracts (Schmidt et al. 1985, FEBS Letters). It was not detected among the major molecular forms released from pig pancreas (Patel and O'Neil, Journal of Biological Chemistry, 1988), suggesting tissue-specific differences in prosomatostatin processing.
• In vitro: SKI-1-mediated cleavage of the N-terminal prosomatostatin segment has been demonstrated in COS-1 and HEK-293 cell expression systems (Mouchantaf et al. 2004, Regulatory Peptides).

Mechanism

Prosomatostatin is a 92-residue intermediate formed after the signal peptide of preprosomatostatin is removed in the endoplasmic reticulum. ProSS1-32 arises from cleavage of prosomatostatin at the Leu32–Leu33 bond — a monobasic cleavage pattern consistent with endoprotease activity. The C-terminal fragment produced at this site (residues 33–92) contains somatostatin-28 and is further processed to somatostatin-14 by prohormone convertases PC1 and PC2 at dibasic and monobasic sites. The N-terminal fragment (proSS1-32) is subsequently processed by SKI-1 at the RXRXXL motif to yield the shorter PSST[1-10] fragment. This N-terminal cleavage pathway is independent of the downstream generation of SS-14 and SS-28; overexpression or knockout of SKI-1 alters PSST[1-10] production without affecting the somatostatin-14/28 output (Mouchantaf et al. 2004, Regulatory Peptides). The raw stored sequence (APSDPRLRQFLQKSLAAAAGKQELAKYFLAEL) represents the 32-residue primary structure as it exists within the prosomatostatin precursor; no post-translational modifications specific to this fragment have been described in the literature.

Open questions

• Whether proSS1-32 has any direct receptor-binding or signaling activity has not been established; no binding data at somatostatin receptors or at GHSR have been published for this fragment.
• The physiological significance of proSS1-32 as a circulating or tissue-resident peptide versus a transient processing intermediate remains unclear.
• Tissue-specific differences in prosomatostatin N-terminal processing (fragment detected in intestine but not pancreas) are not fully explained.
• The full set of physiological functions of antrin (PSST[1-10]), the shorter product derived from this segment via SKI-1, is still being characterized.

Related peptides

ProSS1-32 belongs to the prosomatostatin precursor family. The bioactive C-terminal products of prosomatostatin processing — somatostatin-14 and somatostatin-28 — are the hormonally active members of this lineage. For the growth hormone secretagogue receptor (GHSR) biology context in which this fragment appears in the platform, see also related GH secretagogue peptides including ipamorelin and GHRP-2, which are synthetic ligands at GHSR1a and can be used in receptor binding assays alongside prosomatostatin-derived fragments to establish ligand selectivity profiles.