Calcitonin metabolic peptide
An experimental peptide aimed at the same body system targeted by modern weight and blood-sugar drugs, still in research, not an approved medicine.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Can two targeted tweaks fix the chemical fragility of this molecule before anyone spends money testing it?
If these modifications hold up in the lab, researchers would have a stable, potent starting point for a new class of weight and bone drugs, cutting the time and cost of early development. This matters most to labs deciding whether to invest in making and testing the molecule.
Could the shape of this peptide be tuned so it triggers the bone-protecting signal without causing the body to quickly stop responding?
Long-term calcitonin therapy loses effectiveness because the body adapts and internalizes the receptor. If this peptide could be designed to favour the bone-protecting signal over the adaptation signal, it might offer more durable treatment for osteoporosis or metabolic conditions. That would matter for patients who currently see calcitonin stop working over time.
Is this peptide specific enough that it won't accidentally activate receptors that control blood vessels in the head?
Drugs that unintentionally hit the CGRP receptor can cause vascular side effects. If this peptide's structure naturally avoids that receptor, as this hypothesis suggests, it could have a cleaner safety profile for people using it long-term for weight or metabolic management.
Could this molecule reduce hunger and improve blood sugar through the same mechanism as the approved drug pramlintide, but with a different structure?
Pramlintide works but has practical drawbacks, including injection-site reactions. If this peptide hits the same receptor through a structurally distinct sequence, it could open a path to improved formulations, or even a dual-action drug that pairs well with GLP-1 therapies like semaglutide. This would be relevant to people managing obesity or type 2 diabetes.
Does the loose, unstructured tail of this molecule cause it to detach from its receptor faster, and does that affect how useful it could be as a drug?
A peptide that releases its receptor quickly tends to cause less desensitisation over time, which could be an advantage for chronic conditions like obesity or type 2 diabetes where sustained daily dosing is needed. Understanding this structural detail guides how the molecule might be optimised for real-world use.
If this molecule works through a different brain circuit than GLP-1 drugs, could combining them produce better results than either alone?
GLP-1 drugs like semaglutide are effective but not sufficient for everyone. The combination of amylin-type and GLP-1 signalling is already showing promise in obesity research. If this peptide fills that amylin-type role with a novel structure, it could become part of a combination approach for people who need greater weight loss or glucose control than current drugs provide.
If this molecule only partially switches on the calcitonin receptor, could it still protect bone without causing the blood-calcium drops that full activation can trigger?
Therapeutic calcitonin can lower blood calcium too much, limiting its use. A partial activator could provide a gentler, more controlled effect on bone resorption with a lower risk of that side effect. This would matter for patients with osteoporosis who cannot tolerate full-strength calcitonin therapy.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.7279504537582397 | boltz-2 |
| ranking score | 0.708127498626709 | boltz-2 |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.960 | global PDE — lower = better |
| disorder | NaN | fraction disordered |
▸3-letter notation
▸recipeboltz-2 1.0
| parameter | value |
|---|---|
| model | boltz-2 1.0 |
| weights | — |
| hardware | nvidia_nim_api |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | none |
| diffusion samples | 1 |
| runtime | — |
| predicted by | mlx@peptide |
| predicted at | 2026-04-24 |
▸citationbibtex
@peptide{pep05144,
sequence = {CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP},
target = {glp-1r},
author = {peptidemodel},
year = {2026},
status = {computed}
}