TIMP2 blood-sugar peptide
An experimental peptide that acts on the body's GLP-1 system, the same pathway that helps control blood sugar and appetite. Not an approved medicine.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could a tiny chemical change stop this peptide from breaking down in the bloodstream within minutes?
Right now this peptide likely falls apart in blood plasma in under ten minutes, making it useless as a medicine even if it works in a test tube. If replacing one vulnerable atom extends that window to over an hour, it could become a realistic candidate for an injectable drug, opening the door to actual animal and human testing.
Does this peptide lower blood sugar by a different mechanism than currently assumed, one that puts it in the same class as widely used diabetes drugs?
Knowing exactly how a peptide lowers blood sugar determines whether it belongs in a crowded field of GLP-1 drugs like semaglutide or whether it could compete in the well-established gliptin category. If this hypothesis holds, researchers and developers would measure it against a different, already-validated benchmark, which could clarify its real commercial and therapeutic potential.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.6718364953994751 | openfold3-mlx |
| ranking score | 0.7458521127700806 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.823 | global PDE — lower = better |
| disorder | 0.129 | fraction disordered |
| chain pair ipTM (A, B) | 0.672 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | — |
| hardware | — |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | — |
| diffusion samples | 1 |
| runtime | 535s |
| predicted by | mlx@peptide |
| predicted at | 2026-04-14 |
▸citationbibtex
@peptide{pep05042,
sequence = {CKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFAC},
target = {glp-1r},
author = {peptidemodel},
year = {2026},
status = {computed}
}