type I cytokine receptor superfamily · human

EPOR

erythropoietin receptor
erythropoietin receptor · UniProt P19235 · gene EPOR
cardiovascular inflammation

EPOR is the receptor for erythropoietin (EPO), the hormone regulating red blood cell production. The EPO–EPOR axis is a validated clinical target: recombinant EPO (epoetin alfa) is used for anemia in CKD, chemotherapy, and pre-surgical patients.

Beyond hematopoiesis, EPOR is expressed in the brain, heart, and skeletal muscle where it mediates cytoprotective effects independent of erythropoiesis. Tissue-protective EPO variants (carbamylated EPO, asialo-EPO) that dissociate erythropoietic from neuroprotective activity are under investigation. Peptide-based EPOR agonists (e.g. EMP1, EMP33) have been structurally characterized and serve as design templates. Key challenge: avoiding the erythropoietic effect in non-anemia applications.

browse 2 cards → upload → try → + watch target

anchor card · canonical reference for this target

anchor

Erythropoietin (EPO): Epogen/Procrit red-blood-cell hormone

APPLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR · 165 aa · @peptidemodel

designed pep-10880 @peptidemodel refs: 3

all cards · 2 candidates against EPOR

# id title author status refs ipSAE_d0chn ♥
1 pep-10880 Erythropoietin (EPO): Epogen/Procrit red-blood-cell hormone pe@peptidemodel
3 — 0
2 pep-10908 Cibinetide (ARA-290): experimental nerve-pain drug derived from the EPO hormone pe@peptidemodel
1 — 0
1–2 of 2

target literature · 4 curated papers

[1]
Siepmann, Timo et al. 2014 Neurology Teaching Neuro <i>Images</i> : Macaroni sign
cited by
1
cards
[2]
Besarab, AnatoleBolton, W. KlineBrowne, Jeffrey K.Egrie, Joan C.Nissenson, Allen R.Okamoto, Douglas M. 1998 New England Journal of Medicine The Effects of Normal as Compared with Low Hematocrit Values in Patients with Cardiac Disease Who Are Receiving Hemodialysis and Epoetin
cited by
1
cards
[3]
Pfeffer, Marc A.Burdmann, Emmanuel A.Chen, Chao-YinCooper, Mark E.de Zeeuw, DickEckardt, Kai-Uwe 2009 New England Journal of Medicine A Trial of Darbepoetin Alfa in Type 2 Diabetes and Chronic Kidney Disease
cited by
1
cards
[4]
Jelkmann, Wolfgang 2013 Transfusion Medicine and Hemotherapy Physiology and Pharmacology of Erythropoietin
cited by
1
cards

discussion · 0 threads

No discussion threads yet.