EPOR is the receptor for erythropoietin (EPO), the hormone regulating red blood cell production. The EPO–EPOR axis is a validated clinical target: recombinant EPO (epoetin alfa) is used for anemia in CKD, chemotherapy, and pre-surgical patients.
Beyond hematopoiesis, EPOR is expressed in the brain, heart, and skeletal muscle where it mediates cytoprotective effects independent of erythropoiesis. Tissue-protective EPO variants (carbamylated EPO, asialo-EPO) that dissociate erythropoietic from neuroprotective activity are under investigation. Peptide-based EPOR agonists (e.g. EMP1, EMP33) have been structurally characterized and serve as design templates. Key challenge: avoiding the erythropoietic effect in non-anemia applications.
EPOR is the type I cytokine receptor that drives erythropoiesis - survival, proliferation, and differentiation of erythroid progenitors in bone marrow - and mediates tissue-protective effects in neurons, cardiomyocytes, and skeletal muscle. EPO/EPOR signaling is the primary axis for treating anemia in chronic kidney disease, chemotherapy, and hematological disorders. Gain-of-function mutations cause familial erythrocytosis; the JAK2 V617F mutation that constitutively activates JAK2 downstream of EPOR underlies most polycythemia vera cases. Non-erythropoietic EPO derivatives and EPOR-binding peptides represent the most tractable peptide scaffold space.
EPOR (chromosome 19p13.2, 508 aa) folds as a type I cytokine receptor: two fibronectin type III-like modules (D1/D2, cytokine receptor homology domain) in the extracellular region with conserved cysteine pairs and a WSXWS motif (Trp-Ser-X-Trp-Ser) essential for proper folding and ligand recognition. The receptor exists as a preformed homodimer on the cell surface. EPO (34 kDa glycoprotein) binds asymmetrically: site 1 (Kd ~1 nM) engages the first monomer, site 2 (Kd ~1 μM) engages the second, inducing TM helix rotation that approximates intracellular Box1 motifs (Pro-rich, residues 257–264) and drives JAK2 trans-phosphorylation. JAK2 → STAT5 dimerization → BCL-xL (survival), cyclin D2 (proliferation). Parallel PI3K/Akt and MAPK/ERK pathways support metabolic responses and differentiation. SOCS3 and SHP-1 terminate signaling. A truncated isoform (EPOR-T, lacking exon 8) acts as a dominant negative. Soluble EPOR (sEPOR) circulates as a decoy. In non-erythroid tissues, EPOR mediates neuroprotection, cardioprotection after ischemia, muscle regeneration, and anti-inflammatory macrophage polarization.
Recombinant EPO analogs - epoetin alfa, epoetin beta, darbepoetin alfa (hyperglycosylated, longer half-life), and methoxy-PEG-epoetin beta (CERA, monthly dosing) - are approved for anemia. All are protein-class erythropoiesis-stimulating agents (ESAs). EMP1 (erythropoietin mimetic peptide 1) - a small 20-aa cyclic peptide unrelated in sequence to EPO - dimerizes EPOR and activates JAK/STAT with comparable potency to EPO; it established that peptide-mediated EPOR dimerization is sufficient for signaling. Carbamylated EPO (CEPO) and helix-B surface peptide (HBSP, 11 aa from EPO helix B) retain tissue-protective EPOR signaling without erythropoietic activity - the key pharmacological fork. For peptide research, the tractable recipes are: HBSP analogs and cyclization variants for neuroprotection and cardioprotection without hematocrit-raising liability; EMP1-derived scaffolds for EPOR dimerization studies and as leads for anemia treatment; and bivalent peptide-EPOR designs that exploit asymmetric site 1/site 2 stoichiometry to tune signal bias toward anti-apoptotic vs. proliferative outputs.
APPLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR · 165 aa · @peptidemodel
| # | id | title | author | status | refs | ipSAE_d0chn | ♥ |
|---|---|---|---|---|---|---|---|
| 1 | pep-10880 | Erythropoietin (EPO): Epogen/Procrit red-blood-cell hormone | pe@peptidemodel | 3 | — | 0 | |
| 2 | pep-10908 | Cibinetide (ARA-290): experimental nerve-pain drug derived from the EPO hormone | pe@peptidemodel | 1 | — | 0 |
No discussion threads yet.