Erythropoietin (EPO): Epogen/Procrit red-blood-cell hormone
A kidney hormone that tells bone marrow to make more red blood cells; FDA-approved to treat anemia in kidney disease, chemotherapy, and HIV; banned in sports.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
Erythropoietin (EPO) is a hormone made by the kidneys that tells the bone marrow to produce more red blood cells. When blood oxygen levels fall — because of kidney disease, high altitude, or blood loss — the kidneys ramp up EPO output, the bone marrow responds by making more red cells, and oxygen delivery to tissues recovers. In healthy people this happens continuously and invisibly, keeping hemoglobin in a narrow physiological range. In kidney disease, the damaged kidneys can no longer make enough EPO, and anemia results. Recombinant human EPO (epoetin alfa, sold as Epogen and Procrit; and longer-acting analogs darbepoetin alfa/Aranesp and methoxy PEG-epoetin beta/Mircera) replaces this missing signal and is FDA-approved for anemia of chronic kidney disease, chemotherapy-induced anemia, HIV-related anemia, and perioperative blood conservation. EPO is also the most historically prominent doping agent in endurance sports and is prohibited by WADA at all times.
EPO is a 165-amino-acid glycoprotein of approximately 30.4 kDa. Its raw sequence does not capture several features essential to its biology: two intra-chain disulfide bridges (Cys7–Cys161 and Cys29–Cys33) that maintain the four-helix bundle fold, three N-linked glycans (at Asn24, Asn38, Asn83), and one O-linked glycan (at Ser126) — together accounting for roughly 40% of molecular mass and protecting the protein from proteolysis while modulating receptor-binding affinity and circulatory half-life. None of these modifications appear in the stored 165-letter sequence.
History
The concept of a blood-borne erythropoietic regulator was proposed by Carnot and Déflandre in 1906 ("hemopoiétine"), and cross-circulation parabiosis experiments in the 1950s confirmed that a circulating factor was responsible. After decades of incremental progress, Eugene Goldwasser and colleagues at the University of Chicago purified human erythropoietin to homogeneity in 1977 from hundreds of liters of urine collected from aplastic anemia patients — yielding microgram quantities of pure hormone, enough to permit the first amino acid sequencing and, critically, to serve as the molecular probe material for cloning.
The human EPO gene was cloned in 1985 by Fu-Kuen Lin and colleagues at Amgen, enabling recombinant manufacture in Chinese hamster ovary cells. Epoetin alfa (Epogen, Procrit) received FDA approval in June 1989 for anemia of chronic renal failure, effectively eliminating transfusion dependence for most dialysis patients — a transformation in nephrology that few single drugs have matched. Darbepoetin alfa (Aranesp), a hyperglycosylated analog with approximately threefold longer half-life, was approved by FDA in 2001. Methoxy PEG-epoetin beta (Mircera) followed in Europe (2007), enabling monthly dosing; multiple biosimilars have since been approved globally, making EPO the first major biopharmaceutical to generate a mature biosimilar market.
EPO's second identity emerged almost as quickly as its medical one. Recombinant EPO was circulating among professional cyclists within years of approval, and a cluster of sudden cardiac deaths in European cycling in the late 1980s and early 1990s is widely attributed to uncontrolled hematocrit elevation from unsupervised EPO use. The 1998 Festina affair (Tour de France) and subsequent US Postal/Lance Armstrong revelations made EPO the public face of endurance-sports pharmacology. Anti-doping science caught up in 2000, when Françoise Lasne and Jacques de Ceaurriz published a urinary isoelectric focusing method that distinguishes recombinant EPO's isoform pattern from endogenous EPO. The hematological module of the Athlete Biological Passport (implemented 2009) extended detection by using longitudinal Bayesian analysis of hemoglobin and reticulocyte parameters to flag biologically implausible changes even after the drug itself clears detection.
The 2019 Nobel Prize in Physiology or Medicine (Kaelin, Ratcliffe, Semenza) for the HIF-PHD oxygen-sensing pathway that controls EPO production laid the groundwork for oral HIF-PHD inhibitors (roxadustat, daprodustat, vadadustat) as a next generation of erythropoiesis-stimulating therapy.
What it does
EPO binds to the EPO receptor (EpoR), a homodimeric class I cytokine receptor expressed on committed erythroid progenitors — BFU-E (burst-forming units–erythroid) and CFU-E (colony-forming units–erythroid) — in the bone marrow. Binding keeps these precursor cells alive and drives them through the final steps to become mature red blood cells. The net physiological effect is regulated expansion of the erythron: reticulocyte output rises within a few days, circulating red cell mass increases over weeks, and hemoglobin and oxygen-carrying capacity climb.
Endogenous EPO maintains plasma hemoglobin in a narrow physiological range by sensing tissue oxygen pressure in the renal cortex and adjusting EPO gene transcription accordingly. At therapeutic doses in CKD, recombinant EPO raises hemoglobin by roughly 1–2 g/dL per month and eliminates transfusion dependence (Jelkmann 2013). At supraphysiological doses — as used in doping — hematocrit can rise above 55–60%, dramatically increasing blood viscosity and thrombotic risk.
EPO does not directly improve erythroid iron incorporation; adequate iron stores are required to sustain the erythropoietic response, and functional iron deficiency is the most common cause of ESA hyporesponsiveness.
Evidence
- Human: Extensive randomized controlled trial evidence over three decades. Besarab and colleagues (NEJM 1998) enrolled 1,233 hemodialysis patients with cardiac disease and found that targeting normal hematocrit (~42%) versus a low target (~30%) did not reduce cardiovascular events and increased vascular access thrombosis (39% vs. 29%), with no survival benefit; the trial was halted early on safety grounds. Pfeffer and colleagues (TREAT trial, NEJM 2009) randomized 4,038 patients with type 2 diabetes, pre-dialysis CKD, and anemia to darbepoetin targeting hemoglobin ~13 g/dL versus placebo with rescue darbepoetin; the high-target arm showed no reduction in cardiovascular or renal events but doubled stroke risk (hazard ratio 1.92), with transfusion requirements significantly reduced in the active arm. The CHOIR trial (Singh and colleagues, NEJM 2006) similarly showed increased composite cardiovascular events with epoetin alfa targeting Hb 13.5 g/dL versus 11.3 g/dL in pre-dialysis CKD. The CREATE trial (Drueke and colleagues, NEJM 2006) found no cardiovascular benefit from full hemoglobin normalization in pre-dialysis CKD. Collectively these trials define the modern safety boundary: partial correction (hemoglobin target approximately 10–11 g/dL) reduces transfusion dependence and improves quality-of-life scores, while full normalization increases stroke and cardiovascular events without additional benefit.
- Animal: Comprehensive across multiple decades — erythropoiesis biology, EpoR signaling, and tissue-protective effects in multiple species. EPO and EpoR knockout in mice produces embryonic lethality from failure of definitive erythropoiesis.
- In vitro: Very strong. The HIF-PHD-EPO-EpoR-JAK2-STAT5 axis is one of the best-characterized hormone signaling pathways in physiology (Jelkmann 2013).
Myths and misconceptions
- "EPO is safe because it's a natural hormone" — Endogenous EPO maintains hematocrit in a tightly regulated physiological range. Therapeutic rhEPO raises hematocrit to levels that substantially increase blood viscosity. Multiple professional cyclists died in the late 1980s–early 1990s from apparent thrombotic events attributed to supraphysiological EPO doping. Even in monitored medical settings, targeting higher hemoglobin produces measurably increased cardiovascular harm (Besarab 1998; Pfeffer and colleagues 2009).
- "Higher hemoglobin is always better in anemia" — The CHOIR, TREAT, and Normal Hematocrit trials converge on the finding that targeting hemoglobin above 13 g/dL in CKD patients increases adverse cardiovascular outcomes and stroke risk. Current practice targets partial correction to approximately 10–11 g/dL.
- "EPO protects the brain and heart at therapeutic doses" — Preclinical data and early small trials suggested EPO might have neuroprotective or cardioprotective roles through low-level EpoR expression outside the bone marrow. However, adequately powered randomized trials in preterm neonates, traumatic brain injury, stroke, and myocardial infarction have consistently failed to demonstrate clinical benefit. The derivative peptide ARA-290 (cibinetide) was engineered specifically to target the tissue-protective innate repair receptor (EPO-R/βcR heteromer) without erythropoietic activity, precisely because full-length EPO's cardiovascular risk profile makes it unsuitable for non-anemia indications.
- "Darbepoetin and epoetin are the same drug" — Darbepoetin alfa has two additional N-glycosylation sites (requiring five amino acid substitutions) that more than triple serum half-life to approximately 25 hours, enabling weekly or biweekly dosing versus three-times-weekly for epoetin. Mircera (methoxy PEG-epoetin beta) extends this further to approximately 130–140 hours, enabling monthly dosing.
- "Pure red cell aplasia from EPO is common" — It is rare but serious. Antibody-mediated PRCA was most prominent with a specific Eprex formulation change in Europe in the early 2000s, attributed to leachate from tungsten syringe components causing protein aggregation and increased immunogenicity. Formulation changes have dramatically reduced incidence; cases still occur sporadically and require discontinuation and non-rechallenge with any ESA product.
Common questions
Why is targeting normal hemoglobin harmful in CKD? The mechanism is not fully resolved. Contributing factors include blood hyperviscosity at high hematocrit, higher EPO doses required to achieve normal targets (which may have pro-thrombotic effects independent of hematocrit), the iron supplementation required to sustain erythropoiesis, and possible patient-selection effects (hyporesponders requiring the highest doses may have underlying disease that independently drives adverse outcomes). The doubled stroke risk seen in the TREAT trial (Pfeffer and colleagues 2009) is striking because it occurred in a pre-dialysis population without the extreme hematocrits seen in doping contexts.
What is the difference between epoetin, darbepoetin, and CERA? These are three generations of ESAs with progressively extended half-lives achieved by increased glycosylation or PEGylation. Epoetin alfa (~30.4 kDa) has an IV half-life of approximately 6–9 hours. Darbepoetin alfa (~37.1 kDa) carries two additional N-glycans via five amino acid substitutions and has an IV half-life of approximately 25 hours. Methoxy PEG-epoetin beta/CERA (Mircera; ~60 kDa) is a PEGylated EPO with an IV half-life of 130–140 hours, enabling monthly dosing. As molecular size increases, EpoR binding affinity decreases, but in vivo duration compensates.
How is EPO regulated by hypoxia? The EPO gene has a hypoxia-response element in its 3′ enhancer. Under normoxia, HIF-α subunits — primarily HIF-2α for EPO — are hydroxylated on proline residues by prolyl hydroxylase domain enzymes (PHDs), which require oxygen and α-ketoglutarate. Hydroxylated HIF-2α is ubiquitinated by the von Hippel–Lindau E3 ligase and degraded by the proteasome. Under hypoxia, PHDs lose activity → HIF-2α accumulates → binds HIF-1β → the HIF complex binds the EPO hypoxia-response element → EPO transcription increases exponentially. This is also the pathway exploited by oral HIF-PHD inhibitors (roxadustat, daprodustat) approved in some markets for CKD anemia, which raise endogenous EPO without injecting the protein.
Why does anti-EPO antibody formation cause pure red cell aplasia? Subcutaneous EPO can in rare cases trigger neutralizing anti-EPO antibodies that cross-react with endogenous EPO, abolishing it along with the therapeutic agent. Because endogenous EPO is the sole survival factor for CFU-E progenitors, its neutralization causes selective ablation of the erythroid lineage while leaving myeloid and megakaryocytic lineages intact — hence pure red cell aplasia rather than pancytopenia.
Known effects
- Erythroid progenitor survival and proliferation — established; EPO is the essential survival factor for CFU-E; EPO or EpoR knockout in mice is embryonically lethal from failure of definitive erythropoiesis
- Increased reticulocyte count — within 3–5 days of administration
- Hemoglobin increase of approximately 1–2 g/dL per month — at standard therapeutic doses in CKD anemia (Jelkmann 2013)
- Reduced transfusion dependence — established in CKD (dialysis and pre-dialysis), chemotherapy-induced anemia, and anemia of prematurity
- Vascular access thrombosis increase at high hematocrit targets — 39% vs. 29% in Besarab and colleagues (NEJM 1998)
- Doubled stroke risk with high hemoglobin targets — TREAT trial: hazard ratio 1.92 at hemoglobin target ~13 g/dL in pre-dialysis CKD (Pfeffer and colleagues 2009)
- Hypertension — occurs in a substantial minority of CKD patients; mechanism may involve direct vascular EPO effects and increased blood viscosity
- Potential tumor promotion in certain cancer types — breast, head and neck, non-small-cell lung; ESA use without concurrent myelosuppressive chemotherapy is contraindicated in oncology
Safety signals
Cardiovascular thrombosis with high hemoglobin targets is the dominant safety signal and the basis for FDA black-box warnings on all ESAs. The Normal Hematocrit Study (Besarab and colleagues, NEJM 1998) and TREAT (Pfeffer and colleagues, NEJM 2009) established this signal in large randomized trials.
Stroke: TREAT demonstrated doubled stroke risk (hazard ratio 1.92) when targeting hemoglobin ~13 g/dL in pre-dialysis CKD patients.
Pure red cell aplasia: Rare but severe; predominantly associated with subcutaneous epoetin in specific formulations (Eprex, early 2000s). Incidence is now extremely low with current formulations but requires immediate discontinuation and non-rechallenge when confirmed.
Tumor promotion: ESAs carry a black-box warning for possible shortened overall survival and tumor progression in some cancer types. They are contraindicated in patients with cancer not receiving myelosuppressive chemotherapy and in curative-intent settings.
Hypertension: Consistent signal across trials; blood pressure monitoring required throughout therapy.
Dialysis access thrombosis: Significantly increased at high hematocrit targets (39% vs. 29%; Besarab and colleagues 1998).
Iron deficiency exacerbation: EPO-driven erythropoiesis rapidly depletes iron stores; functional iron deficiency develops without concurrent iron supplementation and is the most common cause of ESA hyporesponsiveness.
Regulatory status
- Epoetin alfa (Epogen, Procrit; Amgen/J&J): FDA-approved June 1989 for anemia of CKD (dialysis and non-dialysis), anemia from zidovudine treatment in HIV, chemotherapy-induced anemia in cancer, and reduction of allogeneic blood transfusion in elective surgery
- Darbepoetin alfa (Aranesp; Amgen): FDA-approved 2001 for CKD anemia and chemotherapy-induced anemia in cancer
- Methoxy PEG-epoetin beta (Mircera; Roche/Vifor): approved in the EU (2007) and many markets for CKD; not approved in the USA
- Biosimilars: Multiple FDA-approved biosimilars (including Retacrit/epoetin alfa-epbx, Pfizer, 2018); EMA approved EPO biosimilars starting 2007 — the first biosimilar approvals by any major regulatory agency
- Black-box warnings (all ESAs): increased risk of death, myocardial infarction, stroke, venous thromboembolism, and tumor recurrence/progression; use the lowest dose sufficient to avoid transfusion; in cancer, ESAs are not indicated except for chemotherapy-induced anemia in patients with non-curative intent
- WADA: Prohibited at all times under S2 (Peptide Hormones, Growth Factors, Related Substances and Mimetics); includes epoetin alfa and beta, darbepoetin alfa, Mircera/CERA, and oral HIF stabilizers that raise endogenous EPO
Related peptides
See also: Somatropin (hGH), IGF-1 LR3
Mechanism
Erythropoietin is a 165-amino-acid glycoprotein produced by peritubular fibroblasts in the renal cortex and, to a lesser extent, by hepatocytes (the dominant site during fetal life). The polypeptide backbone forms four antiparallel α-helices connected by loops, stabilized by two intra-chain disulfide bridges (Cys7–Cys161 and Cys29–Cys33). Four carbohydrate chains — three N-linked (at Asn24, Asn38, Asn83) and one O-linked (at Ser126) — account for approximately 40% of molecular mass, protect the protein from proteolysis, and modulate receptor-binding affinity and circulatory half-life.
HIF-2α–mediated hypoxia sensing (production regulation): In peritubular fibroblasts, EPO gene transcription is controlled by a hypoxia-response element in the 3′ enhancer. Under normoxia, prolyl hydroxylase domain (PHD) enzymes use oxygen and α-ketoglutarate to hydroxylate specific proline residues on HIF-2α (the primary HIF isoform controlling EPO), targeting it for von Hippel–Lindau E3 ligase ubiquitination and proteasomal degradation. Under hypoxia, PHD activity decreases → HIF-2α accumulates → dimerizes with HIF-1β → the complex binds the EPO hypoxia-response element → EPO mRNA transcription increases exponentially (Jelkmann 2013).
EpoR dimerization and JAK2 activation (signal transduction): The EPO receptor (EpoR) functions as a constitutive homodimer, pre-associated with Janus kinase 2 (JAK2) via its cytoplasmic Box1/Box2 domains. One EPO molecule binding across the two extracellular domains induces a conformational change that repositions the two JAK2 molecules for trans-phosphorylation. Activated JAK2 then phosphorylates tyrosine residues on the EpoR cytoplasmic tail, creating docking sites for downstream signaling proteins.
STAT5 → anti-apoptotic transcription: The primary downstream target is STAT5. Phosphorylated STAT5 dimerizes, translocates to the nucleus, and drives transcription of anti-apoptotic genes including Bcl-xL and Pim-1. In CFU-E progenitors, which are highly EPO-dependent, this STAT5–Bcl-xL axis is the dominant mechanism by which EPO prevents apoptosis and permits cell cycle progression through the erythroid amplification phase.
PI3K–Akt and MAPK/ERK pathways: Activated JAK2 also phosphorylates IRS-2, recruiting PI3K and generating PIP3; Akt activation then phosphorylates pro-apoptotic proteins (Bad, Foxo3a). The SHC adaptor recruits the Grb2–SOS cascade → RAS → RAF → MEK → ERK, promoting erythroid progenitor proliferation.
Termination of signaling: EpoR signaling is terminated by the tyrosine phosphatase SHP-1 (dephosphorylates JAK2 and EpoR), SOCS proteins (primarily SOCS3, transcriptionally upregulated by STAT5 as a negative feedback), and endocytosis and lysosomal degradation of the EPO–EpoR complex.
Pharmacokinetics: Epoetin alfa administered intravenously has a half-life of approximately 6–9 hours; volume of distribution approximates plasma volume, consistent with receptor-mediated clearance. Subcutaneous administration produces a slower absorption profile with lower peak concentrations but allows approximately 30% lower dose requirements for equivalent efficacy. Darbepoetin alfa (two additional N-glycans; ~37.1 kDa) has a half-life of approximately 25 hours, enabling weekly or biweekly dosing. Methoxy PEG-epoetin beta (CERA; ~60 kDa; PEGylated) has a half-life of 130–140 hours (IV), enabling monthly dosing (Jelkmann 2013).
Open questions
- The mechanism by which targeting higher hemoglobin doubles stroke risk in CKD patients (TREAT trial) is not fully resolved; the relative contributions of blood viscosity, possible direct EPO vascular effects, and patient selection (hyporesponders requiring highest doses may have underlying disease independently driving adverse outcomes) remain under investigation
- Whether EPO has clinically meaningful cytoprotective effects in the brain or heart independent of its erythropoietic role — and whether such effects can be exploited via carbamylated EPO or modified analogs such as ARA-290 without erythropoietic consequences — remains unresolved after multiple negative human trials
- The biological basis for inter-individual variability in ESA response (hyporesponsiveness) — dominated by inflammation, hepcidin-mediated iron sequestration, and secondary hyperparathyroidism in CKD — is better characterized than before but not fully predictable at the individual patient level
- Optimal hemoglobin target individualization below the established upper limit of 13 g/dL, accounting for comorbidities, stroke risk, and dialysis adequacy, has not been prospectively characterized
- Whether oral HIF-PHD inhibitors (roxadustat, daprodustat, vadadustat), which raise endogenous EPO rather than administering it exogenously, carry the same cardiovascular-risk profile as parenteral ESAs is still being established in post-approval pharmacovigilance
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Does the unusually short disulfide in EPO limit how well the hormone activates its receptor, rather than holding the protein together?
If true, removing or replacing that short bond might make EPO work more efficiently, potentially allowing lower doses to treat anemia in kidney disease or chemotherapy patients.
Did the failed stroke trial use doses too high for the brain's version of the EPO receptor, accidentally turning on harmful effects instead of protective ones?
If the brain uses a different EPO receptor that responds to much lower concentrations, a carefully dosed EPO analog could still become a stroke treatment, helping hundreds of thousands of patients each year who currently have no neuroprotective options.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.6970295906066895 | openfold3-mlx |
| ranking score | 0.8508300185203552 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 1.028 | global PDE — lower = better |
| disorder | 0.385 | ! high disorder |
| chain pair ipTM (A, B) | 0.697 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | — |
| hardware | — |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | — |
| diffusion samples | 1 |
| runtime | 1023s |
| predicted by | mlx@peptide |
| predicted at | 2026-05-03 |
▸citationbibtex
@peptide{pep10880,
sequence = {APPLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR},
target = {epor},
author = {peptidemodel},
year = {2026},
status = {computed}
}