pe
pep-04431 v1 CC-BY-SA-4.0
151015202530
YADAIFTNSYRKVLGQLSARKLLQDIMSRQ

Sermorelin — GHRH(1-29), diagnostic and anti-aging GHRH analog

Synthetic 29-aa N-terminal GHRH fragment; FDA-approved for GH deficiency diagnosis in children; off-label anti-aging and GH optimization; stimulates pulsatile endogenous GH; short t½ requires daily dosing

status bioassayed target GHSR length 30 aa refs 8
fda-approvedghrh-analoggrowth-hormonediagnosticanti-aging
snapshot clinical 0% confidence
Class
GHRH analog (synthetic GHRH 1-29)
Status
Not currently FDA-approved as a commercial product; available in the US through state-licensed compounding pharmacies for off-label use. WADA prohibited at all times (class S2).
Best-supported effect
Stimulation of pulsatile endogenous growth hormone release; clinical efficacy demonstrated in pediatric idiopathic growth hormone deficiency (FDA approval-era trials).
Main caveat
The pediatric GHD evidence base predates the modern recombinant-GH treatment landscape, and the compounding-era adult off-label uses (anti-aging, sleep, body composition) have not been validated in dedicated controlled adult trials.
status 5 / 5 · 2 contributors
prediction metrics boltz-2 1.0
ipTM0.868
pTM0.912
avg pLDDT77.8
ranking score0.796
overview readme

Snapshot

Class: GHRH analog (synthetic GHRH 1-29)
Evidence tier: Human clinical evidence
Status: Not currently FDA-approved as a commercial product; available in the US through state-licensed compounding pharmacies for off-label use. WADA prohibited at all times (class S2).
Best-supported effect: Stimulation of pulsatile endogenous growth hormone release; clinical efficacy demonstrated in pediatric idiopathic growth hormone deficiency (FDA approval-era trials), the indication that supported the 1997 Geref approval.
Main caveat: The pediatric GHD evidence base predates the modern recombinant-GH treatment landscape, and the compounding-era adult off-label uses (anti-aging, sleep, body composition) have not been validated in dedicated controlled adult trials.


What this is

Sermorelin is a synthetic 29-amino-acid peptide corresponding to the N-terminal fragment of human growth hormone-releasing hormone (GHRH 1-29), the shortest portion of native 44-residue GHRH that retains full activity at the GHRH receptor. It was developed by EMD Serono and received two FDA approvals as Geref — a diagnostic indication in 1990 (NDA 19-863) and a therapeutic indication for pediatric idiopathic growth hormone deficiency in 1997 (NDA 20-443). EMD Serono voluntarily discontinued commercial production in 2008; the FDA determined in 2013 that the withdrawal was for commercial, not safety or efficacy, reasons. Sermorelin is currently available in the US only through state-licensed compounding pharmacies, which prescribe it off-label for adult indications that were never part of the original label. Among GHRH analogs it is unusual in having a formal FDA-approval history; CJC-1295 is a modified derivative of the same 1-29 fragment, and tesamorelin is a separately approved full-length analog.


Evidence map

Evidence layerGradeWhat it supports
HumanPhase III / approved-label-eraPediatric idiopathic growth hormone deficiency: pivotal trials supported the 1997 NDA 20-443 approval; Thorner 1996 (n=110, 12 months) reported boosted growth rates in 74% of children at 30 mcg/kg subcutaneous daily
Human (off-label adult)Anecdotal / weakNo dedicated dose-ranging or efficacy RCT in healthy or aging adults is identified in available literature; adult use is described in compounding-pharmacy and anti-aging-clinic reports rather than controlled trials
AnimalModerateSource describes well-characterized GHRH-receptor pharmacology and supportive animal work (rodents, lambs, goats) for receptor activity and GH release; individual animal study results not separately extracted
In vitroModerateReceptor pharmacology, signaling, and degradation studies (DPP-IV cleavage, mast-cell histamine release, adenylate cyclase activation) cited in source; individual assay results not separately extracted
MechanismStrongGHRH-receptor agonism on pituitary somatotrophs is thoroughly characterized: receptor binding → adenylate cyclase / cAMP / PKA → GH synthesis and pulsatile release

Claim check

ClaimVerdictEvidence layerConfidence
Stimulates endogenous pulsatile GH release via the GHRH receptorSupported (human, mechanism)Human pediatric trials and pharmacologyHigh
Effective for pediatric idiopathic growth hormone deficiency at the historical Geref pediatric label regimenSupported (human, pediatric only)Human Phase III / approval-eraHigh
Currently FDA-approvedContradictedRegulatory recordHigh — Geref was withdrawn from the US market in 2008; the 2013 FDA determination addressed reasons for withdrawal, not reinstatement
Effective for adult anti-aging, body composition, or sleep at compounding-era dosesNot establishedHuman (anecdotal / off-label only)Low — no controlled adult efficacy trial identified in source
Safer than exogenous recombinant HGH because pituitary feedback is preservedPartially supportedMechanismMedium — pulsatility and somatostatin feedback are real mechanistic features, but downstream IGF-1 elevation carries the same theoretical long-term concerns as exogenous GH
Discontinued because of safety problemsContradictedRegulatory recordHigh — FDA 2013 Federal Register determination explicitly states withdrawal was not for safety or effectiveness
Permitted in competition because of historical FDA approvalContradictedWADA listHigh — WADA S2 prohibits GHRH and analogs at all times regardless of approval status

Human exposure studied

This section reports exposure used in the historical Geref label and in published human studies. It is not a personalized protocol.

ContextPopulationExposure studiedDurationEndpointLimitation
Historical FDA label (Geref therapeutic, NDA 20-443; withdrawn 2008)Children with idiopathic growth hormone deficiency0.03 mg/kg (30 mcg/kg) subcutaneous once daily at bedtimeContinuous treatment with periodic reassessment of growth velocityLinear growth / growth velocityPediatric indication only; brand product withdrawn 2008; not a current active label
Historical FDA label (Geref Diagnostic, NDA 19-863; 0.05 mg/amp; withdrawn)Patients undergoing pituitary GH-reserve testingSingle IV bolus dose; GH measured at baseline and every 15 min for 1 hourSingle test sessionPituitary GH responseDiagnostic context only; product withdrawn
Pediatric clinical trial — Thorner et al. 1996, GHRH(1-29) in GH-deficient children,Children with growth hormone deficiency (n≈110 referenced)30 mcg/kg subcutaneous once daily12 monthsGrowth-velocity response (74% responders within 6 months reported)Pediatric population; predates modern rhGH-dominant standard of care
Adult off-label compounding-pharmacy useAdults seeking anti-aging, body-composition, or sleep effectsExact regimen not individually extracted; source describes a range of compounding-pharmacy regimens but no controlled adult dose-ranging trialNot established in controlled trialNo validated adult efficacy endpointOff-label; no controlled adult efficacy trial identified in source; compounded preparations are not FDA-reviewed

Safety signals

SignalEvidence contextNotes
Injection-site reactionsHistorical Geref label / human clinical experienceMild, commonly reported
Facial flushingHistorical Geref label / human clinical experienceTransient, related to GHRH-pathway activation
HeadacheHistorical Geref label / human clinical experienceOccasional
Dizziness; altered sense of tasteHistorical Geref label / human clinical experienceReported in approval-era safety data
Caution in epilepsy and untreated hypothyroidismOriginal Geref labelingSource describes labeling-era cautions
Caution in obesity, hyperglycemia, or elevated plasma fatty acidsOriginal Geref labelingSource describes blunted GH response and metabolic context
IGF-1 elevation as downstream pharmacologyMechanism / pediatric label contextTheoretical long-term concerns parallel those of exogenous GH; long-term comparative endpoint trials are not attached
Long-term adult safety at off-label dosesNot establishedNo long-duration controlled adult safety dataset is identified in available literature

Label-era contraindications described in available literature include active or recent-history malignancy, pregnancy (Geref was Pregnancy Category C), breastfeeding (excretion not characterized), uncontrolled diabetes or insulin resistance, uncontrolled hypothyroidism, active acromegaly or pituitary adenoma, severe obesity (efficacy may be reduced), and hypersensitivity to sermorelin or label excipients (historical Geref used mannitol). Drug interactions described in available literature include glucocorticoids (blunt somatotroph response), somatostatin analogs such as octreotide and lanreotide (directly antagonize GHRH signaling), and thyroid status (uncorrected hypothyroidism reduces GH response). These are described as approval-era label and source context, not as clinical management instructions.


Regulatory status

Region / bodyStatusNotes
US (FDA)Not currently approved as a commercial productGeref (NDA 19-863 diagnostic, 1990; NDA 20-443 pediatric therapeutic, 1997) was voluntarily withdrawn by EMD Serono in 2008; NDA approvals formally withdrawn effective June 18, 2009. The 2013 Federal Register determination (78 FR 14095-14096) found the withdrawal was not for reasons of safety or effectiveness. No active FDA approval exists as of 2026.
US (compounding)Available through state-licensed compounding pharmacies under individualized prescription for off-label adult useCompounded preparations are not FDA-reviewed. The FDA's ongoing 503A bulk-substance review has created uncertainty about long-term compounding-pharmacy access; current status should be verified against current FDA lists.
EU (EMA) / UK (MHRA)No current approval identifiedSource describes sermorelin as treated as an unapproved drug for adult wellness indications across most EU member states.
CanadaNo current approval identifiedSource describes sermorelin as treated as an unapproved drug for adult wellness indications.
Australia (TGA)Schedule 4 (prescription-only) classification of GH secretagogues and GHRH analogsSource describes class-level scheduling.
WADAProhibited at all times (class S2: peptide hormones, growth factors, related substances and mimetics)Per source-cited 2026 Prohibited List; LC-MS/MS detection methods exist and athlete sanctions for sermorelin use are described. Prior FDA approval does not exempt the compound from WADA prohibition.

Clinical trials

Trial / sourcePhasePopulationEndpointStatus / result
Geref pediatric pivotal trials supporting NDA 20-443 (pre-1997)Phase III / pivotalChildren with idiopathic growth hormone deficiencyLinear growth / growth velocityCompleted; supported FDA approval in September 1997
Thorner et al. 1996, "Once daily subcutaneous growth hormone-releasing hormone therapy accelerates growth in growth hormone-deficient children during the first year of therapy" (Geref International Study Group),Clinical trial (pediatric)Children with growth hormone deficiencyGrowth-rate response over 12 monthsCompleted; reported 74% response within 6 months at 30 mcg/kg/day
GRF(1-29) human pharmacology and pituitary-response studies (;)Randomized controlled trial (pharmacology)Adult subjects (acromegaly and other pharmacology contexts)GH response under cholinergic / dopaminergic / TRH manipulationPublished pharmacology results
GRF(1-29)NH2 effects on short-term memory in healthy young subjects,Clinical trialHealthy young adultsShort-term memory neuroendocrine endpointsPublished; small exploratory study
Adult-GHD efficacy programNot identifiedAdults with documented or suspected adult-onset GH insufficiencyAdult efficacy endpointpublished literature explicitly states no published, peer-reviewed adult-GHD efficacy RCT of sermorelin with NCT registration is identified; Walker 2006 is a review proposing adult use, not an RCT

Trials are reported as described in the available literature. NCT identifiers were not provided in available literature for the historical pediatric program. Last checked: source date stamp February 2026; trial registry was not independently re-queried in this card-writing pass.


Mechanism

Sermorelin is a GHRH-receptor agonist on anterior-pituitary somatotrophs. Receptor activation engages adenylyl cyclase, raising intracellular cAMP and activating PKA signaling, which promotes both synthesis and pulsatile secretion of growth hormone. Because the peptide is rapidly cleared (plasma half-life on the order of about 6 minutes by the IV route, somewhat longer by the subcutaneous route, with degradation by DPP-IV and other peptidases), each administered dose produces a single transient GH pulse rather than sustained GHRH-receptor occupancy. The hypothalamic-pituitary feedback loop — in particular somatostatin-mediated negative feedback — remains operative, so the GH response is bounded by the pituitary's own regulatory architecture. The downstream pharmacology (GH → hepatic IGF-1) is the same downstream axis engaged by exogenous recombinant GH; what differs is the upstream stimulus and the preservation of pulsatility.


Chemistry

FieldValue
Amino-acid sequenceYADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Length29 amino acids (GHRH 1-29)
TopologyLinear
ModificationC-terminal amide (-NH2)
Molecular weight~3357.9 g/mol (as reported in source; deterministic check from sequence consistent with reported value)
Molecular formulaC₁₄₉H₂₄₆N₄₄O₄₂S (note: source-printed formula contains an apparent transcription artifact in the hydrogen and oxygen counts; reported here from sequence-consistent reconstruction with the formula flagged for review against a primary chemistry source)
CAS number86168-78-7
Salt formAcetate (sermorelin acetate, as marketed historically as Geref)
Sequence confidenceVerified (sequence is consistently reported as the 1-29 N-terminal fragment of human GHRH across both source sections)
Formula confidenceNeeds review (source formula appears to contain a typographic artifact)

Open questions

  • Modern adult efficacy: No dedicated adult-onset GHD or adult anti-aging efficacy RCT for sermorelin is identified in available literature. Establishing whether the pediatric pharmacology translates to a meaningful adult clinical endpoint is the central unresolved question.
  • Long-term safety at off-label adult exposure: The FDA-approval-era safety dataset is pediatric and shorter-term. Long-duration safety in healthy or aging adults using compounding-era regimens is not characterized in the attached source.
  • Pulsatility versus comparable IGF-1 exposure: Whether preservation of pulsatility translates to a different long-term safety margin compared with exogenous recombinant GH at matched IGF-1 exposure has not been tested in long-duration comparative endpoint trials.
  • Compounding-pharmacy product variability: Active pharmaceutical ingredient purity and reconstitution practices vary across compounding pharmacies, and this quality-control variance is not well characterized in the published literature identified.
  • 503A bulk-substance status: The FDA's ongoing 503A review introduces uncertainty about long-term compounding-pharmacy access for sermorelin. Current status should be re-verified against the current FDA list.
  • Modern head-to-head comparison with rhGH: Modern controlled head-to-head comparisons against current-standard recombinant GH in pediatric or adult GHD are limited.
  • Combination use with GHRPs: Sermorelin combined with a growth-hormone-releasing peptide (e.g., ipamorelin) has pharmacological rationale but no controlled human outcome data identified in available literature.
STRUCTURE · PEP-04431 × GHSR
ranking0.796
target interface 4.5Å peptide drag rotate · scroll zoom · right-click pan
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8681477904319763 boltz-2
ranking score 0.7959436774253845 boltz-2
structural qualityopenfold3
metricvaluenote
gpde0.561global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). Sermorelin — GHRH(1-29), diagnostic and anti-aging GHRH analog (pep-04431, v1). PeptideModel. https://peptidemodel.com/card/pep-04431
@peptide{pep04431,
  sequence = {YADAIFTNSYRKVLGQLSARKLLQDIMSRQ},
  target   = {ghsr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
references 8 papers
[5] supporting
[8]
Prakash A et al. 1999 BioDrugs Sermorelin
supporting
in the news 1 article
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use