pe
pep-04432 v1 CC-BY-SA-4.0

Salmon Calcitonin: Miacalcin/Fortical bone-loss & high-calcium drug

A fish-derived hormone that slows bone loss and lowers blood calcium; used to treat post-menopausal osteoporosis and Paget's disease; FDA-approved drug available as a nasal spray or injection.

statusbioassayed targetCALCR length32 aa refs1
fda-approved
status 5 / 5 · 2 contributors
prediction metrics openfold3-mlx 0.3.1
ipTM0.780
pTM0.710
avg pLDDT46.2
ranking score0.866
STRUCTURE · PEP-04432 × CALCR
ranking0.866
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence32 aa
15101520253032
CSNLSTCVLGKLSQEL HKLQTYPRTNTGSGTP
overview readme

What this is

Salmon calcitonin (brand names Miacalcin and Fortical, often abbreviated sCT) is a peptide hormone drug used to slow bone loss and lower blood calcium. It is the synthetic version of a 32-amino-acid hormone first identified in fish, and it is roughly 40–50 times more potent at the human calcitonin receptor than the human version of the same hormone. The body's own calcitonin is made by the parafollicular C-cells of the thyroid gland and acts as a counter-regulator to parathyroid hormone in calcium homeostasis. Salmon calcitonin has been FDA-approved since 1975, originally as an injection, and since 1995 as a once-daily nasal spray. The stored sequence here (CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP) is the bare 32-residue backbone — the active drug additionally carries a C-terminal amide and an intramolecular disulfide bond between Cys1 and Cys7 that closes the N-terminal ring, neither of which is visible in the raw letters.

History

Calcitonin was discovered in 1962 by Harold Copp at the University of British Columbia, who identified a then-unknown calcium-lowering hormone and originally proposed it came from the parathyroid (hence the name) before it was traced to the parafollicular C-cells of the thyroid. Once characterized as a 32-residue peptide, researchers in the 1960s found that the salmon version — produced by the ultimobranchial body in fish — was substantially more potent at human receptors than the human hormone itself, which made it the practical choice for a therapeutic. Synthetic salmon calcitonin (Calcimar, later Miacalcin) received FDA approval in 1975 for parenteral use in Paget's disease of bone, hypercalcemia, and postmenopausal osteoporosis. The intranasal spray was approved in 1995, dramatically improving patient acceptability for chronic osteoporosis use. The PROOF trial (Prevent Recurrence of Osteoporotic Fractures), published in 2000, demonstrated reduced vertebral fracture incidence at the 200 IU/day intranasal dose. A 2012 EMA meta-analysis of 21 trials identified a small but consistent excess malignancy rate in long-term users, leading to EU restrictions and a 2013 FDA labeling update. Calcitonin has since moved out of first-line use for chronic osteoporosis, ceding ground to bisphosphonates, denosumab, and the anabolic agents.

What it does

Calcitonin tells the cells that break down bone — osteoclasts — to stop working. The result is reduced bone resorption, which lowers serum calcium and slows the loss of bone mineral over time. It also has an analgesic effect on acute bone pain that appears to be centrally mediated rather than acting at the fracture site itself. Acute calcium-lowering shows up within hours of a parenteral dose, while measurable suppression of bone-resorption markers from the intranasal form takes days. The clinical effect on bone mineral density is modest compared to bisphosphonates or anabolic agents, which is part of why calcitonin is no longer first-line for chronic osteoporosis.

Mechanism

Salmon calcitonin binds the calcitonin receptor (CTR; gene calcr), a Class B GPCR expressed on osteoclasts, where activation drives cAMP and calcium signaling and triggers rapid osteoclast retraction from bone surfaces. The analgesic effect is thought to involve central serotonergic pathways and beta-endorphin release rather than peripheral action. Salmon calcitonin's enhanced potency relative to the human hormone is attributed to a more stable amphipathic alpha-helix and greater resistance to enzymatic degradation; the receptor-bound conformation has been characterized by X-ray crystallography as a type II turn (Johansson and colleagues, 2016). The N-terminal disulfide ring (Cys1–Cys7) and C-terminal amide are essential structural features of the active molecule and are not represented in the bare 32-letter sequence stored on this card.

Evidence

  • Human: Extensive. Decades of FDA-approved clinical use across hypercalcemia of malignancy, Paget's disease, and postmenopausal osteoporosis. The PROOF trial (2000) demonstrated vertebral fracture reduction at the 200 IU/day intranasal dose; long-term subanalyses of patient responsiveness in chronic users have also been published (PMID 8565031). The 2012 EMA meta-analysis of 21 trials identified a 0.7–2.4 percentage-point absolute increase in malignancy risk with long-term use, which reshaped clinical positioning.
  • Animal and in vitro: Comprehensive. Calcitonin biology, osteoclast receptor signaling, and comparative potency across species variants (salmon, eel, human) are thoroughly characterized in the literature (e.g. PMID 8213232).
  • Mechanistic: Very strong. The calcitonin receptor is well-characterized as a Class B GPCR; receptor-bound structure of salmon calcitonin has been solved by X-ray crystallography (Johansson and colleagues, 2016).

Known effects

  • Inhibition of bone resorption — FDA-approved (Miacalcin, Fortical) for postmenopausal osteoporosis
  • Treatment of Paget's disease of bone — FDA-approved
  • Acute hypercalcemia of malignancy — FDA-approved; calcium-lowering within hours of parenteral dose
  • Analgesia for acute vertebral compression fracture pain — supported by some trial data, with heterogeneous meta-analyses
  • Modest BMD gains at the lumbar spine — typically 1–2% over 1–2 years on intranasal therapy, substantially less than bisphosphonates or anabolic agents

Safety signals

The most consequential safety signal is the 2012 EMA meta-analysis of 21 trials reporting a small but consistent excess in malignancy rate with long-term use — approximately 0.7–2.4 percentage points absolute risk increase. The EMA restricted intranasal calcitonin for postmenopausal osteoporosis on the basis of this signal, and the FDA followed in 2013 with labeling that recommends use only when alternatives are not suitable. Whether the signal is causal or confounded remains debated (see the Overman and colleagues 2013 analysis in Annals of Pharmacotherapy). Common, generally non-serious adverse effects include nasal irritation, dryness, and minor bleeding with the nasal spray (reduced by alternating nostrils), and nausea, flushing, or injection-site reactions with parenteral use. Neutralizing antibodies to salmon calcitonin develop in a meaningful proportion of long-term users and can reduce efficacy over time; tachyphylaxis to the acute calcium-lowering effect also develops with continuous use. Anaphylactic and serious hypersensitivity reactions have been reported.

Regulatory status

  • US: Prescription-only. FDA-approved for postmenopausal osteoporosis (intranasal spray, Miacalcin/Fortical and generics), Paget's disease of bone, and hypercalcemia of malignancy. The 2013 FDA labeling update positions calcitonin as an option only when alternatives are not suitable for postmenopausal osteoporosis. Not a controlled substance.
  • EU: EMA's 2012 review removed the postmenopausal osteoporosis indication for intranasal calcitonin. Remaining EU indications are short-term (up to 4 weeks) for prevention of acute bone loss from sudden immobilization, Paget's disease in patients unresponsive to alternatives, and hypercalcemia of malignancy. The UK MHRA position is similar.
  • WADA: Not specifically named on the Prohibited List. No meaningful performance-enhancing pharmacology in athletes with normal bone metabolism.

Myths and misconceptions

  • "Calcitonin is a first-line treatment for osteoporosis." No longer. Bisphosphonates, denosumab, and the anabolic agents (teriparatide, abaloparatide, romosozumab) all produce larger BMD gains and greater fracture-risk reduction. Following the 2013 FDA labeling change and the 2012 EMA restrictions, calcitonin is positioned as an option only when other agents are not suitable.
  • "Salmon and human calcitonin are equivalent." Salmon calcitonin is roughly 40–50 times more potent at the human calcitonin receptor than human calcitonin, due to a more stable amphipathic alpha-helix and greater resistance to enzymatic degradation. Human calcitonin (Cibacalcin) was largely replaced by salmon calcitonin for these reasons.
  • "The cancer signal makes calcitonin dangerous." The signal from the 2012 EMA meta-analysis is small in absolute terms (~0.7–2.4 percentage points excess in long-term users), and whether it is causal or confounded remains debated. The signal shifted calcitonin out of first-line use because effective alternatives exist — not because the absolute risk is large.
  • "Calcitonin can replace teriparatide for severe osteoporosis." No. Calcitonin is antiresorptive with modest effect; teriparatide is anabolic with substantially larger BMD gains. They serve different roles and are not interchangeable.

Open questions

  • The mechanism and patient-selection predictors of the long-term cancer signal identified in the 2012 EMA meta-analysis are incompletely characterized.
  • The analgesic effect on acute fracture pain appears centrally mediated, but the precise serotonergic and beta-endorphin contributions are not fully resolved.
  • Clinical significance of neutralizing antibody formation in long-term users — including predictors of which patients lose response — is incompletely characterized.
  • Mechanistic crosstalk within the broader calcitonin peptide family (CGRP, amylin, adrenomedullin), each with distinct receptor systems, is incompletely parsed and may be relevant to off-target effects.

Related peptides

  • Teriparatide — parathyroid hormone (1–34) analog used as an anabolic agent for severe osteoporosis. Mechanistically opposite to calcitonin (stimulates new bone formation rather than blocking bone resorption) but used for overlapping indications.
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7797819972038269 openfold3-mlx
ranking score 0.865595817565918 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.799global PDE — lower = better
disorder0.200fraction disordered
chain pair ipTM (A, B)0.780interface quality
3-letter notation
Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime456s
predicted bymlx@peptide
predicted at2026-04-25
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
citationbibtex
peptidemodel (2026). Salmon Calcitonin: Miacalcin/Fortical bone-loss & high-calcium drug (pep-04432, v1). PeptideModel. https://peptidemodel.com/card/pep-04432
@peptide{pep04432,
  sequence = {CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP},
  target   = {calcr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
clinical trials 443 on ct.gov · 8 on EUCTR · checked 2026-05-22
ct.gov trials 443
with results 108
EUCTR 8
PubMed RCT 105
by phase
4phase 12phase 25no phase
by status
6completed1recruiting1active1not yet recruiting1terminated
references 1 papers
[1]
Salmon Calcitonin
See literature Nature 2000
source scaffold
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use