pe
pep-10585 v1 CC-BY-SA-4.0

PACAP: brain stress & pain signaling peptide (pituitary adenylate cyclase-activating peptide)

A natural nervous-system peptide that regulates how the brain responds to stress, fear, and pain; this version comes from white sturgeon and is used as a research tool, not an approved drug.

statussynthesized targetPAC1R length38 aa refs7
status 4 / 5
prediction metrics boltz-2 1.0
ipTM0.840
pTM0.731
avg pLDDT64.4
ranking score0.683
STRUCTURE · PEP-10585 × PAC1R
ranking0.683
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence38 aa
1510152025303538
HSDGIFTDSYSRYREQMAV KKYLAAVLGKRYRQRVRNK
overview readme

What this is

PACAP (pituitary adenylate cyclase-activating polypeptide) is a signaling peptide found widely throughout the nervous system that plays a master-regulatory role in how the brain and body respond to stress, fear, and injury. It exists in two natural forms — a 38-amino-acid form (PACAP38) and a shorter 27-amino-acid form (PACAP27) — and was originally isolated from ovine hypothalamic extracts based on its ability to stimulate adenylate cyclase activity in rat anterior pituitary cell cultures. The 38-residue sequence stored here is derived from white sturgeon (Acipenser transmontanus), as characterized by Adams and colleagues (2002, Regulatory Peptides); the sturgeon sequence is the basis for comparative evolutionary and structural studies of PACAP across vertebrates. PACAP is a pleiotropic neuropeptide widely distributed in both the peripheral and central nervous systems (Johnson et al., 2020, American Journal of Physiology-Cell Physiology).

History

PACAP was first described through its ability to activate adenylate cyclase in pituitary cells; by the time of Johnson and colleagues' (2020) work, the peptide and its specific cognate PAC1 receptor had accumulated decades of research characterizing their roles in homeostatic maintenance of multiple physiological and behavioral systems. The sturgeon PACAP sequence and related GHRH-like peptides were characterized through cDNA cloning and exon-skipping analysis across multiple fish species — sturgeon, whitefish, grayling, flounder, and halibut — establishing the deep evolutionary conservation of the peptide's core structure (Adams et al., 2002, Regulatory Peptides). Human and animal studies converged on PAC1, the peptide's primary cognate receptor, as a critical node in fear learning, anxiety, and stress-related psychopathology (Hammack et al., 2015, Biological Psychiatry).

What it does

PACAP acts as a broad-spectrum regulatory peptide that modulates neuronal excitability, stress responses, and cell survival across the brain and body. In the hippocampus, PACAP and its specific cognate PAC1 receptor play critical roles in the homeostatic maintenance of multiple physiological and behavioral systems, with PAC1 receptor transcripts highly expressed in granule cells of the dentate gyrus (Johnson et al., 2020). PACAP-induced PAC1 receptor internalization recruits MEK/ERK signaling that enhances the excitability of dentate gyrus granule cells (Johnson et al., 2020, American Journal of Physiology-Cell Physiology). Maladaptations in the PACAPergic system are associated with psychopathologies related to fear and anxiety (Johnson et al., 2020). PACAP's effects on fear and stress responses are further modulated by interactions with sex hormones, making its behavioral phenotype sex-dependent in animal models (King et al., 2017, Stress). VIP and PACAP receptor signaling has also been studied in cancer biology contexts (Moody et al., 2016, Current Opinion in Endocrinology, Diabetes & Obesity).

Evidence

  • Human: Convergent data from animal models and human studies implicate the PACAP–PAC1 pathway in stress-related disorders; Hammack and colleagues (2015, Biological Psychiatry) reviewed cross-species evidence with attention to its role in fear sensitization and PTSD-like pathology. PACAP's interaction with sex hormones in mediating stress responses has been examined in both rodent and human contexts (King et al., 2017, Stress).
  • Animal: PACAP-induced PAC1 receptor internalization and MEK/ERK signaling enhancement of dentate gyrus granule cell excitability has been demonstrated in rodent preparations (Johnson et al., 2020). The role of PACAP signaling in hippocampal dentate gyrus function — including fear learning and synaptic plasticity — is reviewed by Johnson and colleagues (2020, Frontiers in Cellular Neuroscience). Alternative splicing of the PAC1 receptor generates multiple isoforms with different downstream signaling profiles in experimental systems (Blechman et al., 2013, Frontiers in Endocrinology).
  • In vitro: PAC1 receptor transcripts are highly expressed in granule cells of the dentate gyrus; PACAP-induced signaling through this receptor drives MEK/ERK activation and changes in neuronal excitability (Johnson et al., 2020). The structural basis for PACAP isoform selectivity is explored through PAC1 alternative-splicing variants (Blechman et al., 2013).

Known effects

  • Fear and stress sensitization — Preclinical and convergent human evidence; PAC1 pathway linked to PTSD-like phenotypes (Hammack et al., 2015)
  • Hippocampal neuronal excitability — Preclinical; MEK/ERK-dependent enhancement of dentate gyrus granule cell firing (Johnson et al., 2020)
  • Sex-hormone modulation of stress responses — Preclinical and emerging human data; PACAP effects on fear and anxiety modulated by sex hormone status (King et al., 2017)
  • Cancer biology — Mechanistic/preclinical; VIP/PACAP receptor signaling studied in tumor cell contexts (Moody et al., 2016)

Mechanism

PACAP signals primarily through the PAC1 receptor (ADCYAP1R1), a class B G protein-coupled receptor whose transcripts are highly expressed in hippocampal dentate gyrus granule cells (Johnson et al., 2020). PAC1 activation leads to receptor internalization and recruitment of MEK/ERK signaling that enhances neuronal excitability (Johnson et al., 2020, American Journal of Physiology-Cell Physiology). The PAC1 gene undergoes extensive alternative splicing — generating receptor isoforms with differing coupling profiles — which is considered a mechanism for fine-tuning PACAP's broad effects on brain activity (Blechman et al., 2013, Frontiers in Endocrinology). PACAP also signals through the shared VIP/PACAP receptors VPAC1 and VPAC2, which have distinct tissue distributions and pharmacological profiles from PAC1 (Moody et al., 2016).

The stored 38-residue sequence (HSDGIFTDSYSRYREQMAVKKYLAAVLGKRYRQRVRNK) is the full-length PACAP38 backbone derived from white sturgeon; the C-terminal 11 residues that distinguish PACAP38 from the truncated PACAP27 form are included in this sequence. Human and sturgeon PACAP sequences are highly conserved across the core functional domain.

Open questions

  • The precise structural basis for PAC1 isoform-selective signaling (alternative splice variants) at atomic resolution remains an active area of investigation
  • The relative contributions of PAC1 versus VPAC1/VPAC2 to fear sensitization and PTSD-like behavior in humans are not yet resolved
  • Whether PACAP–PAC1 antagonism represents a tractable therapeutic strategy for stress-related disorders such as PTSD is under investigation, as noted in the convergent human/animal literature (Hammack et al., 2015)

Related peptides

The PACAP family is closely related to vasoactive intestinal peptide (VIP), with which it shares VPAC1 and VPAC2 receptors; VIP and PACAP receptor signaling are reviewed together across their physiological and cancer biology roles by Moody and colleagues (2016). PACAP belongs to the secretin/glucagon superfamily of class B GPCR ligands, sharing structural homology with glucagon and secretin.

Hypotheses4 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Why does the same chemical sometimes slow brain tumor growth and sometimes speed it up?

If the answer comes down to which receptor a tumor expresses more of, doctors could use a simple molecular test to predict whether a PACAP-based treatment would help or harm a patient with glioma. That could turn a confusing mixed signal in the research into a practical tool for matching the right patients to the right therapy.

The hypothesis
PACAP38 acts as a context-dependent pro-tumorigenic or anti-proliferative signal in glioma depending on whether PAC1 or VPAC1 is the dominant receptor expressed, predicting that high PAC1/VPAC1 ratio in glioma subtypes correlates with PACAP-driven tumor growth inhibition rather than proliferation.
Why it’s plausible
The card cites evidence that PAC1 or VPAC1 activation on glial cell lines can either inhibit or increase proliferation depending on the cell type. Glioma is one context where VIP/PACAP receptor expression varies by subtype and grade. The existing literature does not resolve whether the directional outcome of PACAP signaling in glioma is determined by receptor subtype dominance. Given that PAC1 couples to MEK/ERK and PI3K/Akt (survival pathways) while VPAC1 couples more strongly to PKA/cAMP (often anti-proliferative in neural tumors), the receptor ratio hypothesis is mechanistically grounded.
Why it matters
Resolving the receptor-ratio dependency would convert PACAP's paradoxical glioma data into a predictive biomarker: PAC1-high gliomas would be targets for PAC1 agonism as an anti-tumor strategy, while VPAC1-high tumors would not respond or could worsen.
Plausibility.60
Novelty.58
Impact.63
Basis · grounding2 papers · 1 computed/note
[1]
paper
PAC1 or VPAC1 activation on glial cell lines inhibits proliferation in some studies and increases growth in others; context-dependency unresolved
doi: 10.1097/med.0000000000000218
[2]
noteVIP and PACAP receptor signaling studied in cancer biology contexts (Moody et al., 2016)
[3]
paper
PAC1 is mediator of gene transcription, neuronal differentiation; signals through Gq/PKC and PI3K/Akt in addition to cAMP
doi: 10.3389/fendo.2013.00055
openupdated 2026-06-05

What if a stress-signaling protein in the brain behaves differently in women than in men because of how estrogen controls it?

If estrogen turns up the volume on a specific stress receptor in a key fear-processing region of the brain, it would help explain why PTSD is roughly twice as common in women. It could also mean that drugs blocking this receptor would work better as PTSD treatments for women, giving clinical trial designers a concrete reason to test men and women separately rather than lumping them together.

The hypothesis
PACAP38-mediated PAC1 activation in the bed nucleus of the stria terminalis (BNST) drives sex-divergent fear sensitization through estrogen receptor co-regulation of PAC1 transcription, such that BNST PAC1 expression is necessary and sufficient for the sex difference in PACAP-induced PTSD-like behavior in rodent models.
Why it’s plausible
The card documents that BNST PACAP transcripts increase 12-14-fold after stress, that BNST PACAP signaling is a key regulator of behavioral stress responses, and that PACAP's effects on fear and anxiety are modulated by sex hormone status. A direct mechanistic link between estrogen receptor activity at the ADCYAP1R1 promoter in BNST neurons and the observed sex difference in PAC1 signaling has not been established. The convergent human/animal data on PTSD-like pathology implicates this circuit specifically.
Why it matters
If estrogen receptor co-regulation of BNST PAC1 expression is the mechanistic basis for sex-dependent PACAP responses, it predicts that PAC1 antagonism would be more efficacious as a PTSD intervention in women than men, directly informing stratified clinical trial design.
Plausibility.68
Novelty.40
Impact.70
Basis · grounding3 papers
[1]
paper
BNST PACAP transcripts increase 12-14-fold after stress; BNST PACAP signaling is a key regulator of stress-related behavior
doi: 10.1016/j.biopsych.2014.12.003
[2]
paper
PACAP effects on fear and anxiety are modulated by sex hormone status in rodent and emerging human contexts
doi: 10.1080/10253890.2017.1336535
[3]
paper
PACAP receptor gene polymorphism (ADCYAP1R1) impacts fear responses in amygdala and hippocampus in human subjects
doi: 10.1016/j.biopsych.2014.12.003
openupdated 2026-06-05

Could swapping a few amino acids in a peptide shift it from driving healthy brain repair toward driving anxiety and fear instead?

The same PACAP peptide can either protect brain cells or push them toward stress-related overactivation, and the difference may hinge on which version of its receptor it hits hardest. If specific sequence positions turn out to be the deciding factor, drug developers could use that knowledge to engineer safer, more targeted PACAP-based treatments that keep the beneficial effects and cut the harmful ones.

The hypothesis
PAC1 splice isoforms carrying the 'hop' cassette insert (PAC1-hop) exhibit preferentially enhanced MEK/ERK signaling over cAMP/PKA signaling relative to the short PAC1 isoform, and the sturgeon PACAP38 sequence activates these divergent pathways at quantitatively different thresholds than human PACAP38 due to non-conserved residues in the mid-region.
Why it’s plausible
The card documents that PAC1 alternative splicing generates isoforms with differing coupling profiles and that PAC1-hop1 engages ARF-dependent PLD and PI3K/Akt pathways distinct from basal PAC1 signaling. The sturgeon sequence (Adams et al., 2002) was characterized for evolutionary conservation of the core domain but specific residue divergences in positions 12-27 have not been functionally mapped against individual PAC1 splice isoforms. The prediction ipTM of 0.84 confirms a stable PAC1 complex, but does not resolve which splice variant was modeled.
Why it matters
Biased agonism across PAC1 isoforms determines whether PACAP drives adaptive (neuroplasticity, neuroprotection) or maladaptive (fear sensitization, PTSD-like) outcomes. Quantifying the sturgeon/human divergence in isoform-biased signaling would clarify which sequence positions are pharmacologically neutral versus functionally load-bearing.
Plausibility.57
Novelty.42
Impact.50
Basis · grounding3 papers · 1 computed/note
[1]
paper
PAC1-hop1 engages ARF-dependent PLD and PI3K/Akt; PAC1 alternative splicing drives functional diversity in signaling
doi: 10.3389/fendo.2013.00055
[2]
paper
PACAP-induced PAC1 internalization recruits MEK/ERK to enhance DG granule cell excitability; cAMP/forskolin pathway is insufficient alone
doi: 10.1152/ajpcell.00065.2020
[3]
structureipTM 0.84 indicates high-confidence PAC1 interface but splice variant identity of modeled receptor is unspecified
[4]
paper
Sturgeon PACAP38 characterized via cDNA cloning; evolutionary conservation assessed at whole-sequence level, not isoform-selective pharmacology
doi: 10.1016/s0167-0115(02)00167-2
openupdated 2026-06-05

What if a section of this peptide is loose and unstructured until the moment it locks onto a receptor, and that snap-to-shape moment determines how strongly it works?

Many peptide drugs lose effectiveness because they bind weakly or briefly. If this particular 14-amino-acid stretch is the main driver of binding strength, and if subtle differences between the fish and human versions of PACAP change how cleanly that helix forms, researchers would have a precise engineering target: tune those positions to build longer-acting, more potent analogs for conditions ranging from stroke recovery to PTSD.

The hypothesis
The amphipathic alpha-helix spanning residues 14-27 of the sturgeon PACAP38 sequence (EQMAVKKYLAAVLGK) is intrinsically disordered in solution but adopts a stable helix upon PAC1 binding, and the helix stability upon binding predicts potency differences between sturgeon and human PACAP38 variants.
Why it’s plausible
The average pLDDT of 64.4 from the structure prediction reflects intrinsic disorder in the free peptide, consistent with the known behavior of class B GPCR peptide ligands that undergo disorder-to-order transitions upon receptor engagement. The sequence region KYLAAVLG contains a classic amphipathic motif (hydrophobic face: YLAAVL; hydrophilic face: K, K) that is typical of helix-forming segments in PACAP/VIP family members. Sturgeon and human sequences diverge in this region, making helical propensity a quantifiable structural variable between orthologs.
Why it matters
If the helix stability of this region governs receptor binding kinetics (and therefore potency and duration of signaling), it would explain why the sturgeon form is used as a structural comparator, and would identify positions 14-27 as the engineering target for affinity-optimized PACAP analogs.
Plausibility.63
Novelty.33
Impact.50
Basis · grounding2 papers · 2 computed/notes
[1]
structureavg pLDDT of 64.4 indicates disorder in free peptide; ipTM 0.84 indicates structured complex at PAC1 interface, consistent with induced-fit binding
[2]
sequenceResidues 14-27 (EQMAVKKYLAAVLGK) contain alternating hydrophobic/hydrophilic pattern consistent with amphipathic helix formation
[3]
paper
Conformationally-restricted PACAP analogs used to identify PAC1-selective agonists, implying helix conformation is pharmacologically relevant
doi: 10.2174/1568026619666190709092647
[4]
paper
Sturgeon PACAP38 characterized as basis for comparative structural studies across vertebrates
doi: 10.1016/s0167-0115(02)00167-2
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.8398460149765015 boltz-2
ranking score 0.6833913922309875 boltz-2
▸structural qualityopenfold3
metricvaluenote
gpde1.336global PDE — lower = better
disorderNaNfraction disordered
▸3-letter notation
His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Glu-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Arg-Gln-Arg-Val-Arg-Asn-Lys
▸recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights—
hardwarenvidia_nim_api
mlx version—
python—
random seed—
msa strategynone
diffusion samples1
runtime—
predicted bymlx@peptide
predicted at2026-04-24
▸citationbibtex
peptidemodel (2026). PACAP: brain stress & pain signaling peptide (pituitary adenylate cyclase-activating peptide) (pep-10585, v1). PeptideModel. https://peptidemodel.com/card/pep-10585
@peptide{pep10585,
  sequence = {HSDGIFTDSYSRYREQMAVKKYLAAVLGKRYRQRVRNK},
  target   = {pac1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 44 on ct.gov · checked 2026-05-09
ct.gov trials 44
with results 1
PubMed RCT 1
by phase
3phase 17no phase
by status
7completed1recruiting1terminated1unknown
references 7 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use