PACAP: brain stress & pain signaling peptide (pituitary adenylate cyclase-activating peptide)
A natural nervous-system peptide that regulates how the brain responds to stress, fear, and pain; this version comes from white sturgeon and is used as a research tool, not an approved drug.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
PACAP (pituitary adenylate cyclase-activating polypeptide) is a signaling peptide found widely throughout the nervous system that plays a master-regulatory role in how the brain and body respond to stress, fear, and injury. It exists in two natural forms — a 38-amino-acid form (PACAP38) and a shorter 27-amino-acid form (PACAP27) — and was originally isolated from ovine hypothalamic extracts based on its ability to stimulate adenylate cyclase activity in rat anterior pituitary cell cultures. The 38-residue sequence stored here is derived from white sturgeon (Acipenser transmontanus), as characterized by Adams and colleagues (2002, Regulatory Peptides); the sturgeon sequence is the basis for comparative evolutionary and structural studies of PACAP across vertebrates. PACAP is a pleiotropic neuropeptide widely distributed in both the peripheral and central nervous systems (Johnson et al., 2020, American Journal of Physiology-Cell Physiology).
History
PACAP was first described through its ability to activate adenylate cyclase in pituitary cells; by the time of Johnson and colleagues' (2020) work, the peptide and its specific cognate PAC1 receptor had accumulated decades of research characterizing their roles in homeostatic maintenance of multiple physiological and behavioral systems. The sturgeon PACAP sequence and related GHRH-like peptides were characterized through cDNA cloning and exon-skipping analysis across multiple fish species — sturgeon, whitefish, grayling, flounder, and halibut — establishing the deep evolutionary conservation of the peptide's core structure (Adams et al., 2002, Regulatory Peptides). Human and animal studies converged on PAC1, the peptide's primary cognate receptor, as a critical node in fear learning, anxiety, and stress-related psychopathology (Hammack et al., 2015, Biological Psychiatry).
What it does
PACAP acts as a broad-spectrum regulatory peptide that modulates neuronal excitability, stress responses, and cell survival across the brain and body. In the hippocampus, PACAP and its specific cognate PAC1 receptor play critical roles in the homeostatic maintenance of multiple physiological and behavioral systems, with PAC1 receptor transcripts highly expressed in granule cells of the dentate gyrus (Johnson et al., 2020). PACAP-induced PAC1 receptor internalization recruits MEK/ERK signaling that enhances the excitability of dentate gyrus granule cells (Johnson et al., 2020, American Journal of Physiology-Cell Physiology). Maladaptations in the PACAPergic system are associated with psychopathologies related to fear and anxiety (Johnson et al., 2020). PACAP's effects on fear and stress responses are further modulated by interactions with sex hormones, making its behavioral phenotype sex-dependent in animal models (King et al., 2017, Stress). VIP and PACAP receptor signaling has also been studied in cancer biology contexts (Moody et al., 2016, Current Opinion in Endocrinology, Diabetes & Obesity).
Evidence
- Human: Convergent data from animal models and human studies implicate the PACAP–PAC1 pathway in stress-related disorders; Hammack and colleagues (2015, Biological Psychiatry) reviewed cross-species evidence with attention to its role in fear sensitization and PTSD-like pathology. PACAP's interaction with sex hormones in mediating stress responses has been examined in both rodent and human contexts (King et al., 2017, Stress).
- Animal: PACAP-induced PAC1 receptor internalization and MEK/ERK signaling enhancement of dentate gyrus granule cell excitability has been demonstrated in rodent preparations (Johnson et al., 2020). The role of PACAP signaling in hippocampal dentate gyrus function — including fear learning and synaptic plasticity — is reviewed by Johnson and colleagues (2020, Frontiers in Cellular Neuroscience). Alternative splicing of the PAC1 receptor generates multiple isoforms with different downstream signaling profiles in experimental systems (Blechman et al., 2013, Frontiers in Endocrinology).
- In vitro: PAC1 receptor transcripts are highly expressed in granule cells of the dentate gyrus; PACAP-induced signaling through this receptor drives MEK/ERK activation and changes in neuronal excitability (Johnson et al., 2020). The structural basis for PACAP isoform selectivity is explored through PAC1 alternative-splicing variants (Blechman et al., 2013).
Known effects
- Fear and stress sensitization — Preclinical and convergent human evidence; PAC1 pathway linked to PTSD-like phenotypes (Hammack et al., 2015)
- Hippocampal neuronal excitability — Preclinical; MEK/ERK-dependent enhancement of dentate gyrus granule cell firing (Johnson et al., 2020)
- Sex-hormone modulation of stress responses — Preclinical and emerging human data; PACAP effects on fear and anxiety modulated by sex hormone status (King et al., 2017)
- Cancer biology — Mechanistic/preclinical; VIP/PACAP receptor signaling studied in tumor cell contexts (Moody et al., 2016)
Mechanism
PACAP signals primarily through the PAC1 receptor (ADCYAP1R1), a class B G protein-coupled receptor whose transcripts are highly expressed in hippocampal dentate gyrus granule cells (Johnson et al., 2020). PAC1 activation leads to receptor internalization and recruitment of MEK/ERK signaling that enhances neuronal excitability (Johnson et al., 2020, American Journal of Physiology-Cell Physiology). The PAC1 gene undergoes extensive alternative splicing — generating receptor isoforms with differing coupling profiles — which is considered a mechanism for fine-tuning PACAP's broad effects on brain activity (Blechman et al., 2013, Frontiers in Endocrinology). PACAP also signals through the shared VIP/PACAP receptors VPAC1 and VPAC2, which have distinct tissue distributions and pharmacological profiles from PAC1 (Moody et al., 2016).
The stored 38-residue sequence (HSDGIFTDSYSRYREQMAVKKYLAAVLGKRYRQRVRNK) is the full-length PACAP38 backbone derived from white sturgeon; the C-terminal 11 residues that distinguish PACAP38 from the truncated PACAP27 form are included in this sequence. Human and sturgeon PACAP sequences are highly conserved across the core functional domain.
Open questions
- The precise structural basis for PAC1 isoform-selective signaling (alternative splice variants) at atomic resolution remains an active area of investigation
- The relative contributions of PAC1 versus VPAC1/VPAC2 to fear sensitization and PTSD-like behavior in humans are not yet resolved
- Whether PACAP–PAC1 antagonism represents a tractable therapeutic strategy for stress-related disorders such as PTSD is under investigation, as noted in the convergent human/animal literature (Hammack et al., 2015)
Related peptides
The PACAP family is closely related to vasoactive intestinal peptide (VIP), with which it shares VPAC1 and VPAC2 receptors; VIP and PACAP receptor signaling are reviewed together across their physiological and cancer biology roles by Moody and colleagues (2016). PACAP belongs to the secretin/glucagon superfamily of class B GPCR ligands, sharing structural homology with glucagon and secretin.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Why does the same chemical sometimes slow brain tumor growth and sometimes speed it up?
If the answer comes down to which receptor a tumor expresses more of, doctors could use a simple molecular test to predict whether a PACAP-based treatment would help or harm a patient with glioma. That could turn a confusing mixed signal in the research into a practical tool for matching the right patients to the right therapy.
What if a stress-signaling protein in the brain behaves differently in women than in men because of how estrogen controls it?
If estrogen turns up the volume on a specific stress receptor in a key fear-processing region of the brain, it would help explain why PTSD is roughly twice as common in women. It could also mean that drugs blocking this receptor would work better as PTSD treatments for women, giving clinical trial designers a concrete reason to test men and women separately rather than lumping them together.
Could swapping a few amino acids in a peptide shift it from driving healthy brain repair toward driving anxiety and fear instead?
The same PACAP peptide can either protect brain cells or push them toward stress-related overactivation, and the difference may hinge on which version of its receptor it hits hardest. If specific sequence positions turn out to be the deciding factor, drug developers could use that knowledge to engineer safer, more targeted PACAP-based treatments that keep the beneficial effects and cut the harmful ones.
What if a section of this peptide is loose and unstructured until the moment it locks onto a receptor, and that snap-to-shape moment determines how strongly it works?
Many peptide drugs lose effectiveness because they bind weakly or briefly. If this particular 14-amino-acid stretch is the main driver of binding strength, and if subtle differences between the fish and human versions of PACAP change how cleanly that helix forms, researchers would have a precise engineering target: tune those positions to build longer-acting, more potent analogs for conditions ranging from stroke recovery to PTSD.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.8398460149765015 | boltz-2 |
| ranking score | 0.6833913922309875 | boltz-2 |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 1.336 | global PDE — lower = better |
| disorder | NaN | fraction disordered |
▸3-letter notation
▸recipeboltz-2 1.0
| parameter | value |
|---|---|
| model | boltz-2 1.0 |
| weights | — |
| hardware | nvidia_nim_api |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | none |
| diffusion samples | 1 |
| runtime | — |
| predicted by | mlx@peptide |
| predicted at | 2026-04-24 |
▸citationbibtex
@peptide{pep10585,
sequence = {HSDGIFTDSYSRYREQMAVKKYLAAVLGKRYRQRVRNK},
target = {pac1r},
author = {peptidemodel},
year = {2026},
status = {synthesized}
}