pe
pep-10547 v1 CC-BY-SA-4.0

Brain-signal blocker used to study fear and pain (PACAP-38 (6-38))

A lab-made fragment of the brain peptide PACAP-38 that blocks the PAC1 receptor, helping researchers study how that signal drives fear responses, nerve pain, and bladder overactivity. Used only as a lab research tool.

statussynthesized targetPAC1R length33 aa refs2
status 4 / 5
prediction metrics boltz-2 2.2.1
ipTM0.715
pTM0.753
avg pLDDT44.9
ranking score0.502
STRUCTURE · PEP-10547 × PAC1R
ranking0.502
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 2.2.1 · mmCIF ↓ download
sequence33 aa
15101520253033
FTDSYSRYRKQ MAVKKYLAAVL GKRYKQRVKNK
overview readme

What this is

PACAP(6-38) is a truncated version of the brain peptide PACAP-38 that blocks one of PACAP's receptors rather than activating it. In the lab it is the standard tool for "turning off" the PAC1 receptor so researchers can ask what that receptor normally does — whether in fear circuits in the amygdala, in pain pathways relayed through the trigeminal system, or in the nerves that supply the urinary bladder. It is a research peptide, not an approved drug. The stored sequence (FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK, 33 aa) is the parent PACAP-38 with its first five N-terminal residues (HSDGI) removed — that N-terminal truncation is the entire reason the peptide binds the receptor but no longer triggers it.

History

PACAP(6-38) was identified as a potent PACAP-receptor antagonist by Robberecht and colleagues in 1992, working at the Université Libre de Bruxelles (Robberecht et al., European Journal of Biochemistry, 1992). They screened a panel of 46 PACAP analogs — including N-terminally shortened fragments — on human neuroblastoma NB-OK-1 cell membranes, looking for variants that still bound PACAP receptors but failed to activate adenylate cyclase. PACAP(6-38) emerged from that screen as the lead antagonist and has been used in that role ever since. Its long-running utility in neuroscience traces directly to that 1992 paper; the molecule itself is the experimental tool that made the PACAP/PAC1 receptor axis tractable.

What it does

PACAP(6-38) sits in the same binding pocket as full-length PACAP at the PAC1 receptor and prevents the natural peptide from switching the receptor on. In animal experiments this lets researchers ask what happens when PAC1 signaling is selectively blocked — and across multiple models, blocking it dampens stress-driven, pain-driven, and overactive-bladder behaviors that depend on PACAP. The selectivity is imperfect: PACAP(6-38) also has activity at the closely related VPAC2 receptor, so interpretation of experiments uses it as a "PAC1-preferring" antagonist rather than an absolute one (Liao et al., Current Topics in Medicinal Chemistry, 2019).

Mechanism

PAC1 is a class B G-protein-coupled receptor for PACAP that, when activated by full-length PACAP-38 or PACAP-27, couples primarily to adenylyl cyclase/cAMP and phospholipase C/IP3 pathways, with downstream MEK/ERK and Akt signaling — much of the ERK arm running through receptor internalization and endosomal signaling (Liao et al., Current Topics in Medicinal Chemistry, 2019). PACAP(6-38) is competitive at the orthosteric site: the first five residues of PACAP-38 (HSDGI) carry the activation message, and removing them yields a peptide that still occupies the receptor but no longer engages the conformational change needed to recruit G-proteins (Robberecht et al., European Journal of Biochemistry, 1992).

A practical caveat for readers of the literature: PACAP(6-38) behaves as a clean antagonist in most central and peripheral neural assays, but in a subset of cell systems it has been reported to produce agonist-like effects rather than block PACAP. This tissue-dependent behavior is part of why studies that use it as an antagonist typically pair it with genetic or other pharmacological controls.

Evidence

  • Human: No human trials of PACAP(6-38) as a therapeutic. Human relevance is indirect, through genetic and biomarker work on the PACAP/PAC1 axis itself — most prominently the finding that a single ADCYAP1R1 (PAC1) variant and elevated blood PACAP levels associate with PTSD diagnosis and symptoms in women but not men (Ressler et al., Nature, 2011).
  • Animal: Intravesical PACAP(6-38) (300 nM) increased intercontraction interval (~2.0-fold) and void volume (~2.5-fold) in NGF-overexpressing mice — a model of chronic bladder hyperactivity and pelvic sensitization driven by urothelial NGF (Girard et al., Journal of Molecular Neuroscience, 2016). In a nitroglycerin-induced chronic migraine model in male rats, PACAP6-38 reduced nociceptive sensitization and trigeminal nucleus caudalis activation, with the effect tracking changes in ERK/CREB/BDNF signaling and dendritic spine density (Zhang et al., The Journal of Headache and Pain, 2023). In stress and fear-conditioning paradigms, amygdala-targeted PACAP(6-38) blocked anxiety- and pain-related responses, providing proof-of-principle that PAC1R antagonism can interrupt established stress states (reviewed in Liao et al., Current Topics in Medicinal Chemistry, 2019).
  • In vitro: PACAP(6-38) blocks PACAP-induced adenylyl cyclase activation on human neuroblastoma NB-OK-1 membranes — the original characterization (Robberecht et al., European Journal of Biochemistry, 1992).

Known effects

  • PAC1 receptor antagonism (preferred research use) — Mechanistic, in vitro and in vivo
  • Reduction of bladder hyperactivity and pelvic sensitivity in NGF-OE mice — Preclinical (Girard et al., 2016)
  • Reduction of central sensitization in a chronic migraine model — Preclinical (Zhang et al., 2023)
  • Blockade of stress- and fear-related amygdala signaling — Preclinical, mechanistic (reviewed Liao et al., 2019)

Regulatory status

  • US: Research peptide only. Not FDA-approved. No active IND program for PACAP(6-38) itself.
  • EU: Research peptide only. No EMA marketing authorization.
  • WADA: Not specifically listed; the broader class of peptide hormones and growth-factor-related research peptides falls under WADA S2 by analogy, but PACAP(6-38) has no anti-doping case law and no athletic-performance use case.

Related peptides

  • PAC1 is the receptor for the endogenous neuropeptide PACAP (pituitary adenylate cyclase-activating polypeptide); PACAP(6-38) is derived from the 38-residue form of that peptide. PACAP is closely related to vasoactive intestinal peptide (VIP), and the PAC1 receptor sits in the same class B GPCR family as the VIP receptors VPAC1 and VPAC2 (Liao et al., Current Topics in Medicinal Chemistry, 2019). PACAP(6-38)'s residual VPAC2 activity is the reason "PAC1-selective" is the more accurate label than "PAC1-specific."
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.7150619029998779 boltz-2
ranking score 0.5024647116661072 boltz-2
▸3-letter notation
Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys
▸recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights—
hardwarevast_v100_32gb
mlx version—
python—
random seed1
msa strategycolabfold_local
runtime—
predicted by—
predicted at2026-05-22
▸citationbibtex
peptidemodel (2026). Brain-signal blocker used to study fear and pain (PACAP-38 (6-38)) (pep-10547, v1). PeptideModel. https://peptidemodel.com/card/pep-10547
@peptide{pep10547,
  sequence = {FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK},
  target   = {pac1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 34 on ct.gov · checked 2026-05-22
ct.gov trials 34
with results 1
PubMed RCT 3
by phase
2phase 11phase 47no phase
by status
6completed1recruiting1active1terminated1unknown
references 2 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use