pe
pep-10565 v1 CC-BY-SA-4.0

Galanin: brain-calming neuropeptide (rat 1-29 form)

A natural signaling peptide released in the brain, spinal cord, and gut that quiets overactive nerve cells and may help suppress seizures; used mainly as a lab research tool.

statussynthesized targetGALR1 length29 aa refs10
status 4 / 5
prediction metrics boltz-2 2.2.1
ipTM0.726
pTM0.865
avg pLDDT76.4
ranking score0.757
STRUCTURE · PEP-10565 × GALR1
ranking0.757
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 2.2.1 · mmCIF ↓ download
sequence29 aa
151015202529
GWTLNSAGYLLGPHA IDNHRSFSDKHGLT
overview readme

What this is

Galanin (1–29) is the full-length form of galanin found in rats and most non-primate mammals — a 29-amino-acid neuropeptide released by neurons throughout the brain, spinal cord, and gut where it dampens the firing of nearby cells. It was first cloned from a rat hypothalamic cDNA library, where it appears as part of a larger 124-amino-acid precursor that also yields a separate fragment called galanin message-associated peptide, or GMAP (Kaplan 1988). The stored sequence here (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT) is the rat 29-residue form; in the precursor it carries a C-terminal glycine that is removed during maturation (Kaplan 1988), and mature galanin in most species is C-terminally amidated — that amide is not represented in the raw 1-letter sequence shown here. Galanin draws interest because its receptors sit at the intersection of seizure control, pain, mood, feeding, and insulin release, which has made the system a long-running target for neurological and metabolic drug discovery (Freimann 2015).

History

The galanin peptide and its gene were first characterized in rat hypothalamus in the late 1980s, with Kaplan and colleagues (1988) reporting the cDNA-derived structure of the 124-residue rat preprogalanin precursor. The deduced rat sequence proved to be roughly 90% identical to the previously known porcine galanin, with the small handful of differences clustered toward the C-terminus (Kaplan 1988). The receptor side of the system was filled in over the following decade: GalR1 was cloned first, GalR2 was identified as a distinct subtype (Wang 1997), and GalR3 was cloned in human and rat shortly after (Smith 1998), giving the three-receptor family that is still used today (Webling 2012).

What it does

When galanin (1–29) binds one of its three receptors (GalR1, GalR2, or GalR3), it generally turns down activity in the cell it is acting on (Webling 2012). In the central nervous system this shows up as anticonvulsant activity — galanin and galanin-receptor activation suppress seizure-like firing patterns, and the galanin system is regarded as an endogenous brake on seizures (Kapur 2011). In the periphery, the most classical action is in the pancreas, where galanin suppresses insulin release from β cells; this was historically the very first activity reported for galanin and is mediated by a pertussis-toxin-sensitive Gi/o-family G protein, specifically Gαo2 (Tang 2012). Galanin signalling has additionally been implicated in feeding, mood, learning and memory, nociception, and spinal reflexes (Tang 2012).

Mechanism

Galanin (1–29) acts at three class A GPCRs — GalR1, GalR2, and GalR3 — that differ in their G-protein coupling and tissue distribution (Webling 2012). GalR1 and GalR3 couple predominantly to inhibitory Gi/o proteins, while GalR2 has a broader coupling profile (Webling 2012). On pancreatic β cells, galanin's inhibition of glucose-stimulated insulin release was shown to operate specifically through the Gαo2 subunit of the Gi/o family, identified by genetic loss-of-function in mice (Tang 2012). At GalR3, the N-terminal fragment galanin (2–11) — a tool ligand often used as a putative GalR3-preferring probe — was shown in transfected cell lines to bind GalR3 with affinity comparable to full-length galanin, but with limitations as a clean subtype-selective probe (Lu 2005). The N-terminal portion of galanin (roughly residues 1–16) is generally the region required for high-affinity receptor binding across the family (Webling 2012).

Evidence

  • Human: No human clinical trials of galanin (1–29) itself are documented in the dossier; clinical interest has focused on subtype-selective small-molecule and peptide analogs rather than the native 29-mer (Freimann 2015).
  • Animal: Anticonvulsant effects of galanin and galanin-receptor agonists in rodent seizure models underpin the seizure-modulation literature (Kapur 2011). Inhibition of insulin release by galanin has been demonstrated in mouse pancreatic β cells, with Gαo2 identified as the required G-protein subunit by genetic knockout (Tang 2012). GalR2-preferring analogs derived from the galanin scaffold (e.g., NAX 810-2) have shown analgesic activity in rodent pain models with preclinical safety characterization (Metcalf 2017).
  • In vitro: GalR1, GalR2, and GalR3 have been cloned and pharmacologically characterized in transfected cell lines, establishing the three-receptor framework used to interpret galanin pharmacology (Wang 1997; Smith 1998; Lu 2005).

Known effects

  • Seizure suppression — Preclinical (rodent models, endogenous-system pharmacology; Kapur 2011)
  • Inhibition of insulin release — Preclinical, mechanism mapped to Gαo2 (Tang 2012)
  • Modulation of feeding, mood, nociception, learning — Mechanistic / preclinical literature, system-level (Tang 2012; Freimann 2015)

Regulatory status

Galanin (1–29) is an endogenous neuropeptide and is not an approved drug in any jurisdiction documented in the dossier. The galanin receptor system is described in the literature as a potential therapeutic target for neurological disease, but as of the cited reviews development has been pursued mainly through subtype-selective analogs rather than the native peptide (Freimann 2015).

Related peptides

  • Galanin-like peptide (GALP) — a related hypothalamic peptide that shares the galanin N-terminal region and binds galanin receptors, with documented roles in energy homeostasis and reproduction (Lawrence 2011).
  • Galanin (2–11) — an N-terminal fragment used as a research tool ligand and originally proposed as GalR3-preferring, with later work showing its selectivity is limited (Lu 2005).
  • NAX 810-2 — a GalR2-preferring galanin analog developed as an analgesic lead with preclinical safety characterization (Metcalf 2017).
Hypotheses3 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-11

Does galanin suppress dopamine reward circuits by physically linking to the dopamine receptor?

If galanin and dopamine receptors form a direct partnership, scientists could design molecules that calm craving circuits in addiction or psychosis without blocking dopamine everywhere in the brain, cutting unwanted movement side effects.

The hypothesis
Galanin's co-release with dopamine in mesolimbic circuits reduces D2 receptor-driven reward signaling not only by direct GalR1-mediated hyperpolarization but also through a heteroreceptor interaction in which galanin binding to GalR1 directly allosterically attenuates co-expressed D2 receptor signaling in the same neuron.
Why it’s plausible
The snippet explicitly notes galanin interactions with D2 dopamine receptors producing unwanted physiological effects. Galanin and dopamine neurons co-exist in the mesolimbic system. GalR1 and D2 are both Gi-coupled GPCRs and are co-expressed on ventral tegmental area neurons. Direct GalR1-D2 heterodimer formation could explain why galanin modulates addiction-relevant circuits beyond simple inhibitory co-transmission.
Why it matters
If galanin acts through GalR1-D2 heteroreceptor complexes, targeting this complex could suppress pathological reward without fully blocking D2 (avoiding movement side effects), which is directly relevant to addiction and antipsychotic drug design.
Plausibility.55
Novelty.70
Impact.65
Basis · grounding1 paper · 1 computed/note
[1]
paper
Galanin system interacts with D2 dopamine receptors, ghrelin, and melanocortin receptors, producing physiological effects attributable to receptor cross-talk.
doi: 10.3389/fendo.2012.00146
[2]
sequenceGWTLNSAGYLLGPHAIDNHRSFSDKHGLT contains the N-terminal GalR1-binding motif needed to drive any GalR1-mediated receptor-receptor interaction.
openupdated 2026-06-11

Could the unamidated form of rat galanin favor one receptor subtype over another?

If true, this could explain why some galanin effects differ across tissues and species, and could help drug designers make more targeted galanin-based treatments with fewer side effects.

The hypothesis
The rat 1-29 galanin sequence (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT) without C-terminal amidation displays measurably lower GalR1 binding affinity than the native amidated form, yet retains near-full GalR2 potency, making the non-amidated form a natural GalR2-selective probe.
Why it’s plausible
GalR1 and GalR2 differ in their tolerance for C-terminal modifications. The readme notes that mature galanin is C-terminally amidated and the stored sequence lacks that amide. The snippet confirms galanin(2-11) already favors GalR2, suggesting GalR2 is less sensitive to C-terminal charge. If amidation primarily stabilizes GalR1 interaction, the non-amidated 1-29 form would be differentially selective.
Why it matters
A naturally non-amidated form that selects GalR2 over GalR1 would clarify which receptor mediates galanin effects in pain and mood circuits, and provide a template for designing receptor-selective analogs without synthetic amidation.
Plausibility.50
Novelty.60
Impact.55
Basis · grounding1 paper · 2 computed/notes
[1]
noteMature galanin is C-terminally amidated; the stored rat sequence lacks that amide modification.
[2]
paper
Galanin(2-11) has higher affinity for GalR2 than for GalR1, indicating the receptor subtypes differ in sensitivity to truncations and modifications.
doi: 10.1016/j.npep.2004.12.013
[3]
sequenceC-terminus ends in ...KHGLT with free carboxyl; no amide represented in GWTLNSAGYLLGPHAIDNHRSFSDKHGLT.
openupdated 2026-06-11

Could cyclizing rat galanin protect it from breakdown while keeping it active?

The lysine in the SFSDKHGLT tail sits at position 25 (not 26), and bridging it all the way to the start of the peptide would loop in the binding-critical front region, so the design would need care to avoid weakening receptor activity. The broad idea of constraining the easily-degraded tail is still reasonable for making a longer-lasting galanin drug.

The hypothesis
Replacing the flexible C-terminal SFSDKHGLT segment (residues 21-29) of rat galanin with a rigid cyclic staple or lactam bridge between the Lys at position 26 and the N-terminus generates a constrained analog with prolonged half-life and retained GalR1 potency, because that region contributes minimally to receptor contacts but is the primary site of peptidase cleavage.
Why it’s plausible
The stored sequence ends with KHGLT; Lys-26 (K in SFSDKHGLT) provides a side-chain amine for chemical stapling to the N-terminal amine. The readme and fragment pharmacology data indicate the C-terminus is less conserved. Peptidases typically attack flexible, exposed termini. Constraining this tail via a K26-to-N-terminus bridge would reduce proteolytic access without burying the N-terminal GalR1 pharmacophore.
Why it matters
Galanin analogs suffer from rapid in vivo degradation. An end-to-side-chain cyclized rat galanin that maintains GalR1 potency and resists proteolysis would be a superior pharmacological tool and a step toward CNS-accessible galanin mimetics for seizure or pain therapy.
Plausibility.50
Novelty.50
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceK at position 26 (SFSDKHGLT) provides an amine handle; N-terminal G has a free alpha-amine, enabling a 26-residue head-to-sidechain lactam.
[2]
structurepLDDT=76.4 and ipTM=0.726 indicate the C-terminal portion is structurally flexible and less engaged in the receptor interface.
[3]
paper
N-terminal fragment galanin(2-11) retains receptor binding, confirming C-terminal residues are dispensable for core pharmacophore activity.
doi: 10.1016/j.npep.2004.12.013
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7257987856864929 boltz-2
ranking score 0.7565782070159912 boltz-2
3-letter notation
Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr
recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights
hardwarevast_v100_32gb
mlx version
python
random seed1
msa strategycolabfold_local
runtime
predicted by
predicted at2026-05-22
citationbibtex
peptidemodel (2026). Galanin: brain-calming neuropeptide (rat 1-29 form) (pep-10565, v1). PeptideModel. https://peptidemodel.com/card/pep-10565
@peptide{pep10565,
  sequence = {GWTLNSAGYLLGPHAIDNHRSFSDKHGLT},
  target   = {galr1},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 2 on ct.gov · checked 2026-05-22
ct.gov trials 2
PubMed reviews 4
by phase
2no phase
by status
2completed
references 10 papers
[1]
Tissue-specific expression of the rat galanin gene.
Kaplan, L. et al. Proceedings of the National Academy of Sciences 1988
evidence
[2]
Galanin Receptors and Ligands
Webling, K. et al. Frontiers in Endocrinology 2012
evidence
[4] supporting
[5] supporting
[6]
Cloned Human and Rat Galanin GALR3 Receptors
Smith, K. et al. Journal of Biological Chemistry 1998
supporting
[7] supporting
[8]
Galanin receptors as a potential target for neurological disease
Freimann, K. et al. Expert Opinion on Therapeutic Targets 2015
supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use