Waprin-Thr1 cancer-fighting peptide
A small protein fragment studied in the lab for its ability to fight cancer cells; experimental, not yet an approved drug.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Was this peptide put in the wrong category, and does it actually belong in the antibiotic bucket?
If the anticancer label turns out to be a data-entry error copied from generic food-protein studies, researchers could stop running expensive cancer cell tests and instead run cheap bacterial growth tests that the whole waprin family has historically passed. Correcting the record early saves lab money and could surface a genuine antibiotic candidate faster.
Could this peptide work against cancer by blocking the enzymes tumor cells use to cut through surrounding tissue?
Certain cancers spread by secreting enzymes (matriptase, hepsin) that dissolve the barriers around them. If Waprin-Thr1 can fit into and block those enzymes, it might slow invasion and metastasis in people with aggressive solid tumors, giving doctors a new way to interfere with spread rather than just tumor size.
Could this peptide do double duty, helping against cancer while also protecting patients from dangerous bacterial infections?
Chemotherapy weakens the immune system, leaving patients vulnerable to serious bacterial infections. If Waprin-Thr1 turns out to have both anticancer and antibacterial effects, it could address two major threats at once, which would be especially valuable for patients already burdened with a difficult treatment regimen.
Is there a specific short stretch of this peptide that holds the whole structure in the right shape for it to work?
If mutating that hinge region switches off the peptide's activity, scientists could potentially cut the molecule roughly in half and still keep the useful part. A shorter peptide is cheaper and faster to manufacture, which matters a lot for any treatment that might need to be produced at scale.
Could this peptide be gentler on healthy cells than typical anticancer peptides, while still hitting tumors?
Most anticancer peptides carry a strong positive charge that can damage healthy cells as well as cancer cells, causing side effects. If Waprin-Thr1's near-neutral charge still allows it to home in on cancer cells through a different surface feature, it could offer a wider safety margin, meaning effective doses less likely to harm surrounding normal tissue.
Could this peptide be taken as a pill rather than an injection and still reach a tumor alive?
Almost all peptide drugs must be injected because stomach acid and digestive enzymes destroy them. If Waprin-Thr1's four interlocking disulfide bonds protect it from those enzymes, it could one day be given orally, which would be a major convenience and cost benefit for patients with gastrointestinal cancers in particular.
Does this peptide kill cancer cells by tearing open their outer surface rather than by blocking a specific molecular switch?
Many cancer drugs stop working over time because tumors evolve to hide or change the specific target the drug was designed for. If Waprin-Thr1 works by physically punching holes in the cancer cell membrane, tumors would have a much harder time developing resistance, potentially making it more durable as a treatment.
▸full evidence table1 metrics
| metric | value | tool |
|---|---|---|
| ranking score | 0.7231149077415466 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | none_monomer |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep05286,
sequence = {ENEKAGSCPDVNQPIPPLGLCRNMCESDSGCPNNEKCCKNGCGFMTCSRPR},
target = {anticancer},
author = {peptidemodel},
year = {2026},
status = {computed}
}