Anticancer peptide
A peptide studied in the lab for its potential to fight cancer cells; experimental, not yet an approved drug.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could the same molecule that targets cancer cells also kill dangerous bacteria?
If this holds, a single drug candidate could potentially treat both tumors and bacterial infections, which is rare and would make it far more valuable to develop. This matters most for patients who face both challenges at once, such as those on immunosuppressive cancer therapy.
Does this molecule destroy cancer cells by punching holes in their outer shell, instead of blocking a specific protein?
If cancer cells are killed by direct membrane rupture rather than by targeting a single protein, tumors could find it much harder to develop resistance, the way they often do against targeted drugs. That could mean longer-lasting treatment responses for patients.
Would this molecule attack cancer cells without damaging the healthy tissue around them?
Many membrane-attacking cancer drugs cause collateral damage to normal cells. If this peptide's tightly folded shape limits that collateral damage, it could offer a wider margin between the dose that works and the dose that causes side effects, making it safer to use in practice.
Is there one small region of the peptide that does most of the work of attacking cancer cells?
If a specific short segment is responsible for membrane attack, chemists could swap out just those few building blocks to make a stronger version, without rebuilding the entire molecule. That would accelerate the path from a natural scaffold to an optimized drug candidate.
Could cutting off the unused part and connecting the ends into a ring make this peptide practical to manufacture and use as a drug?
The current molecule is long and expensive to synthesize, and the body breaks down linear peptides quickly. If a shorter, circular version keeps the same cancer-killing activity, it could become manufacturable at realistic cost and survive long enough in the bloodstream to actually reach a tumor.
Could this peptide find cancer cells on its own by latching onto a molecular marker that most tumors expose on their surface?
Most cancer drugs work only on tumors with a specific mutation or protein. If this peptide homes in on a lipid signal that a broad range of cancers share, it could potentially be useful across many different cancer types without needing to be redesigned for each one.
▸full evidence table1 metrics
| metric | value | tool |
|---|---|---|
| ranking score | 0.7491890788078308 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | none_monomer |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep05190,
sequence = {MVTLVLLVFLLLNVVEDEAASFPFSCPTLSGVCRKLCLPTEMFFGPLGCGKGFLCCVSHF},
target = {anticancer},
author = {peptidemodel},
year = {2026},
status = {computed}
}