Pancreastatin: natural hormone that raises blood sugar
A hormone fragment released by the pancreas that blocks insulin release and raises blood sugar levels; found naturally in the body, not an approved drug.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
Endogenous peptide — produced naturally and routinely synthesized for research
Fork this card to add platform evidence →
Endogenous peptide — receptor binding and activity established in published literature
Fork this card to add platform evidence →
What this is
Pancreastatin is a peptide hormone derived from chromogranin A (CHGA), a large precursor protein found in secretory granules of pancreatic cells, adrenal chromaffin cells, and other neuroendocrine tissues. CHGA is processed into several distinct bioactive fragments — pancreastatin is the fragment from the mid-region of the precursor, while vasostatin-1 comes from the N-terminus and catestatin from the C-terminus. Pancreastatin's defining action is inhibiting glucose-stimulated insulin release from pancreatic β-cells while simultaneously stimulating glucagon secretion from α-cells — a net pro-hyperglycemic effect. The stored 56-aa human sequence (EGTFHREKDQLQEEGKSHEPPEGKREMEDNFQGTAEKHREHKVHSPVAAENLMAFN) is not C-terminally amidated in the database, though the native mature form carries a C-terminal amide that was present in the original porcine peptide isolated in 1986; the human sequence differs from the porcine form at several positions.
Pancreastatin has no approved therapeutic use. It is studied as a biomarker in neuroendocrine tumors and as a research tool for understanding the CHGA-derived peptide regulatory system.
History
Pancreastatin was discovered in 1986 by Kazuhiko Tatemoto and colleagues at the Karolinska Institute in Stockholm. Working with porcine pancreatic tissue, they applied bioactivity-guided fractionation — monitoring inhibition of glucose-stimulated insulin secretion from perfused rat pancreas — to isolate a novel peptide. The purified 49-amino acid C-terminally amidated porcine peptide was named "pancreastatin" for its pancreatic origin and inhibitory character. Sequence analysis and cDNA work revealed it was a fragment of the CHGA precursor protein (Tatemoto and colleagues 1986).
This was the first evidence that chromogranin A, previously regarded as a structural co-secretory granule protein, was itself a prohormone generating biologically active regulatory peptides. The discovery opened the entire field of CHGA-derived peptide biology, encompassing vasostatin, catestatin, WE14, and other fragments from the same precursor.
The human pancreastatin sequence was subsequently determined from the human CHGA gene and found to differ from the porcine form at several positions. Human pancreastatin retains the insulin-inhibitory and glucagon-stimulatory activities, though potency differences between the human and porcine forms have been noted. Plasma pancreastatin levels were found to be elevated in type 2 diabetes mellitus, hypertension, and obesity, drawing interest in its role as a metabolic biomarker.
What it does
Inhibition of glucose-stimulated insulin secretion: Pancreastatin's primary and best-characterized action is suppression of insulin release from pancreatic β-cells in response to glucose and other secretagogues. In perfused rat pancreas preparations, porcine pancreastatin inhibited glucose-stimulated insulin secretion in a concentration-dependent manner (Tatemoto and colleagues 1986). The mechanism involves coupling to Gi proteins, leading to decreased cAMP accumulation and reduced intracellular calcium mobilization in β-cells, blunting the normal glucose-sensing secretory response.
Stimulation of glucagon secretion: While inhibiting insulin, pancreastatin simultaneously stimulates glucagon release from pancreatic α-cells. This dual action (↓ insulin, ↑ glucagon) creates a net pro-hyperglycemic effect. In isolated mouse pancreatic islets and perfused mouse pancreas, pancreastatin inhibited glucose-stimulated insulin secretion while stimulating glucagon release, establishing it as a net pro-hyperglycemic pancreatic regulatory peptide distinct from somatostatin, which inhibits both hormones (Ahrén and colleagues 1988).
Inhibition of somatostatin release: Pancreastatin also inhibits somatostatin secretion from pancreatic δ-cells. The net result of these three actions — suppressed insulin, elevated glucagon, reduced somatostatin — is a state of relative hyperglycemia and metabolic activation.
Gastrointestinal effects: Beyond the pancreatic islet, pancreastatin inhibits acetylcholine-stimulated gastric acid secretion, reduces gut motility, and modulates the secretion of additional GI hormones. These actions parallel somatostatin in some respects but are mediated through a distinct receptor and peptide system.
Adrenergic synergy: Pancreastatin is co-released with catecholamines from adrenal chromaffin cells and may contribute to stress-associated hyperglycemia by suppressing insulin secretion while catecholamines simultaneously promote hepatic glucose output.
Biomarker role in metabolic disease: Plasma pancreastatin levels are elevated in type 2 diabetes mellitus, metabolic syndrome, and obesity compared to healthy controls. This correlation is consistent with pancreastatin's insulin-inhibitory biology, though whether elevated pancreastatin contributes causally to impaired insulin secretion in T2DM or reflects increased CHGA processing under chronic metabolic stress remains under investigation.
Evidence
- Human: Pancreastatin has not been evaluated as a therapeutic agent in human trials. Its principal human-relevant evidence comes from measurement of circulating pancreastatin levels as a biomarker: levels are elevated in type 2 diabetes mellitus, hypertension, and metabolic syndrome compared to healthy controls.
- Animal: Porcine pancreastatin inhibited glucose-stimulated insulin secretion from perfused rat pancreas in the original 1986 isolation study (Tatemoto and colleagues 1986). Mouse islet and perfused mouse pancreas studies confirmed pancreastatin inhibits insulin secretion while stimulating glucagon at concentrations in the low micromolar range (Ahrén and colleagues 1988).
- In vitro: Receptor pharmacology studies showed that pancreastatin's β-cell effects involve Gi-protein coupling, decreased cAMP, and reduced intracellular calcium mobilization, distinguishing its receptor mechanism from the SST1–5 receptor pathway used by somatostatin.
Myths and misconceptions
- "Pancreastatin is a form of somatostatin because both inhibit insulin." Pancreastatin and somatostatin are structurally unrelated peptides from entirely different precursor genes. Somatostatin (gene SST) is a cyclic disulfide-bonded peptide that inhibits both insulin and glucagon via SST1–5 receptors. Pancreastatin (from CHGA) stimulates glucagon while inhibiting insulin and acts through a distinct receptor system — the net islet consequences are fundamentally different.
- "Pancreastatin causes insulin resistance." Pancreastatin's documented actions are at the secretory level — reducing insulin release from β-cells — not at the level of insulin signaling in muscle, adipose, or liver. Whether pancreastatin directly contributes to peripheral insulin resistance is not established. Elevated plasma pancreastatin in T2DM likely reflects increased CHGA processing under chronic metabolic stress rather than a primary etiological role in insulin resistance per se.
- "Measuring chromogranin A in a clinical lab directly reflects pancreastatin levels." Standard clinical chromogranin A assays measure intact CHGA protein (or specific intact-protein epitopes) rather than processed mid-region fragments like pancreastatin. Pancreastatin-specific immunoassays require antibodies targeting the mid-region fragment and give different absolute values and disease correlations than total CHGA assays, which are primarily elevated in neuroendocrine tumors.
Common questions
Q: How does pancreastatin differ from somatostatin analogs used clinically (e.g., octreotide)? A: Both pancreastatin and somatostatin (or its synthetic analogs) inhibit insulin secretion, but through entirely different receptor systems and with opposite effects on glucagon. Somatostatin acts at SST1–5 receptors and inhibits both insulin (from β-cells) and glucagon (from α-cells). Pancreastatin inhibits insulin while stimulating glucagon — a fundamentally different pharmacological profile. Octreotide's clinical utility in neuroendocrine tumors and carcinoid syndrome is SST2/SST5-mediated; pancreastatin has no approved clinical role and is not interchangeable with somatostatin analogs.
Q: Could blocking pancreastatin be a diabetes therapy? A: This has been proposed theoretically. Pancreastatin's insulin-inhibitory and glucagon-stimulatory effects are pro-hyperglycemic, so antagonizing pancreastatin — rather than administering it — could theoretically enhance β-cell secretory function in patients where elevated pancreastatin is impairing insulin output. As of 2026, this remains a theoretical strategy without clinical development programs.
Q: How is pancreastatin related to vasostatin-1? A: Both are bioactive fragments of the same chromogranin A (CHGA) precursor, but from different regions: vasostatin-1 comes from the N-terminus and pancreastatin from the mid-region. They co-circulate as CHGA processing products and are both used as neuroendocrine biomarkers. Unlike insulin A and B chains, which must combine to function, vasostatin-1 and pancreastatin act independently as separate regulatory peptides with distinct biological targets. See vasostatin-1.
Related peptides
- Vasostatin-1 — N-terminal CHGA-derived fragment from the same chromogranin A precursor; co-circulates with pancreastatin as a complementary CHGA processing product and neuroendocrine biomarker
- ACTH / Corticotropin — another bioactive peptide derived from a larger precursor protein (POMC), illustrating the broader "prohormone → multiple active fragments" pattern that characterizes both CHGA and POMC biology
▸3-letter notation
▸citationbibtex
@peptide{pep04485,
sequence = {EGTFHREKDQLQEEGKSHEPPEGKREMEDNFQGTAEKHREHKVHSPVAAENLMAFN},
target = {},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}