Vasostatin-1: heart-calming hormone released alongside adrenaline
A natural peptide released from the adrenal glands alongside adrenaline; slows heart force and rate, counters stress-driven blood-vessel tightening, and kills some bacteria and fungi. Not an approved drug, used as a research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
Endogenous peptide — produced naturally and routinely synthesized for research
Fork this card to add platform evidence →
Endogenous peptide — receptor binding and activity established in published literature
Fork this card to add platform evidence →
What this is
Vasostatin-1 is an 80-amino acid N-terminal fragment of chromogranin A (CHGA), a large acidic secretory protein stored in dense-core chromaffin granules of the adrenal medulla and co-secreted with catecholamines during adrenergic activation. It is classified as a chromogranin A-derived peptide — one of several biologically active fragments (others include pancreastatin, catestatin, and WE14) generated by proteolytic processing of the CHGA precursor. Vasostatin-1 exerts negative inotropic (reduced cardiac contractile force) and negative chronotropic (reduced heart rate) effects on the heart, blunts catecholamine-induced vasoconstriction, and possesses antimicrobial and antifungal activity. The stored sequence LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHS (80 aa) represents the CGA1-80 form; the most widely cited functional form in the literature is CGA1-76, which is fully contained within it — the 4 additional C-terminal residues (KKHS) reflect variability in processing-enzyme cut-site specificity and do not alter the known biological activities.
The name "vasostatin" was coined to reflect its vasoinhibitory properties — it opposes the vasoconstrictive and positive inotropic effects of catecholamines released simultaneously from chromaffin granules, functioning as an autocrine/paracrine brake on sympathoadrenal stimulation. Vasostatin-1 has no approved therapeutic use.
History
Chromogranin A was first characterized by Blaschko and colleagues in 1967 as a major soluble protein of bovine adrenal medullary chromaffin granules, where it is co-stored with epinephrine and norepinephrine. The full protein (457 aa) was recognized as a neuroendocrine marker and later shown to be proteolytically processed in vivo to yield multiple regulatory peptides.
The N-terminal fragment now called vasostatin-1 was characterized functionally by Aardal and Helle in 1992 using isolated heart preparations. That work demonstrated that a bovine chromogranin A N-terminal fragment (CGA1-76) inhibited cardiac contractility independent of extracellular calcium, establishing that CHGA-derived fragments could directly oppose catecholamine-induced stimulation — a novel autocrine regulatory concept. The fragment was named "vasostatin" to reflect its vasodilatory/vasoinhibitory properties (Aardal and Helle 1992).
Lugardon and colleagues at INSERM Strasbourg subsequently characterized the antimicrobial properties of vasostatin-1 in a 2000 paper in the Journal of Biological Chemistry, demonstrating potent bactericidal and fungicidal activity in the low micromolar range. That work established vasostatin-1 as a natural host-defense peptide with dual cardiovascular and antimicrobial roles — a function consistent with its release during the intense sympathoadrenal stress response when pathogen exposure risk is also elevated (Lugardon and colleagues 2000).
Subsequent work established that the structurally relevant antimicrobial core of vasostatin-1 lies in the C-terminal portion (approximately CGA47-76, termed "chromofungin"), while the cardiovascular regulatory effects involve the entire CGA1-76 domain through interactions with cardiac β-adrenergic signaling pathways.
What it does
Negative inotropic and chronotropic cardiac effects: Vasostatin-1 reduces myocardial contractile force (negative inotropy) and slows heart rate (negative chronotropy) in cardiac preparations. The mechanism involves modulation of β-adrenergic receptor signaling — vasostatin-1 attenuates the positive inotropic response to isoproterenol and reduces cAMP accumulation in cardiomyocytes. In the frog heart model, vasostatin-1 produces dose-dependent negative inotropic effects that are calcium-independent, suggesting a mechanism downstream of calcium entry involving cAMP-PKA signaling (Amato and colleagues 2005). These effects are particularly relevant during stress (fight-or-flight) responses when vasostatin-1 is co-released with the catecholamines it dampens.
Vasodilation and anti-vasoconstrictive activity: Vasostatin-1 opposes catecholamine-mediated vasoconstriction in vascular smooth muscle. The vasodilatory effect is partly endothelium-dependent (involves nitric oxide) but also has direct smooth muscle components. This counter-regulatory vascular activity complements the negative cardiac inotropic effect to create an overall dampening of sympathoadrenal cardiovascular stimulation.
Antimicrobial and antifungal activity: Vasostatin-1 kills gram-positive and gram-negative bacteria and a range of fungal species (including multiple Candida strains) at low micromolar concentrations in vitro. The antimicrobial activity is membrane-disruptive — vasostatin-1 adopts an amphiphilic structure in membrane-mimicking environments and permeabilizes bacterial and fungal cell membranes. The active antimicrobial core resides primarily in the C-terminal portion (CGA47-76, chromofungin) (Lugardon and colleagues 2000). This represents a plausible innate defense function: during acute stress-induced chromaffin granule exocytosis, vasostatin-1 is released alongside catecholamines at sites of potential infection or injury, providing local antimicrobial coverage.
Co-release with catecholamines: Vasostatin-1 is stored in the soluble compartment of adrenal medullary chromaffin granules and is quantitatively co-secreted with epinephrine upon stimulation of nicotinic acetylcholine receptors. Plasma vasostatin-1 levels rise measurably during acute stress and in conditions associated with sustained adrenergic activation (pheochromocytoma, heart failure). It thus functions as an endogenous feedback inhibitor of catecholamine action — part of the broader chromogranin "granulostatin" regulatory system.
Evidence
- Human: No interventional trials with vasostatin-1 as a therapeutic agent have been published. Vasostatin-1 and chromogranin A-derived fragments are measured as biomarkers in human studies of neuroendocrine tumors, heart failure, and pheochromocytoma.
- Animal: Negative inotropic and vasoinhibitory effects characterized in isolated perfused guinea-pig hearts (Aardal and Helle 1992) and in frog heart under pressure-overload conditions (Amato and colleagues 2005).
- In vitro: Bactericidal activity against gram-positive organisms (Staphylococcus aureus, Listeria monocytogenes) and gram-negative organisms (Escherichia coli, Pseudomonas aeruginosa) and fungicidal activity against Candida albicans and Saccharomyces cerevisiae demonstrated in the low micromolar range (Lugardon and colleagues 2000).
Myths and misconceptions
- "Vasostatin-1 is an inhibitor of the vasopressin system." The name "vasostatin" is sometimes interpreted as indicating a relationship to vasopressin (antidiuretic hormone/ADH) — it does not. "Vasostatin" derives from "vaso-" (referring to blood vessels/vasoconstriction) and the inhibitory suffix "-statin." Vasostatin-1 has no direct interaction with the vasopressin receptor or the renin-angiotensin-aldosterone axis; its cardiovascular actions are specifically anti-adrenergic.
- "Vasostatin-1 is the same as chromofungin." Vasostatin-1 (CGA1-76 or CGA1-80) and chromofungin (CGA47-76) are different peptides. Chromofungin is the C-terminal subdomain of vasostatin-1, isolated as a smaller fragment with particularly potent antimicrobial activity. Vasostatin-1 contains the chromofungin sequence but also includes the N-terminal ~46 aa that contribute to its cardiovascular actions. Both peptides can be derived from the same vasostatin-1 precursor by additional processing.
- "High vasostatin-1 plasma levels are specific to pheochromocytoma." Plasma chromogranin A (and its derived fragments including vasostatin-1) is elevated in multiple neuroendocrine tumors, in heart failure, in hypertension, in renal failure (due to impaired clearance), and with proton pump inhibitor use (which induces gastrin-chromogranin A axis activation). High plasma chromogranin-derived peptide levels require clinical context for interpretation; vasostatin-1 alone is not a specific pheochromocytoma marker.
Common questions
Q: How does vasostatin-1 function as a "brake" on catecholamine release? A: During acute stress, the adrenal medulla releases epinephrine and norepinephrine to increase heart rate, cardiac contractility, and peripheral vasoconstriction. Simultaneously, chromaffin granule exocytosis releases the soluble CHGA protein into circulation, where it is cleaved to produce vasostatin-1 among other fragments. Vasostatin-1 directly opposes catecholamine-induced positive inotropy at the cardiac level and blunts catecholamine-mediated vasoconstriction peripherally. This creates a feedback loop where the magnitude of adrenergic stimulation is partly self-limited by the CHGA-derived counter-regulatory fragments co-released with the catecholamines. This "granulostatin" auto-regulatory system represents a form of neuroendocrine autoregulation.
Q: Is the longer stored sequence (80 aa) functionally different from the classic CGA1-76 form? A: Published functional data on vasostatin variants focuses primarily on the CGA1-76 and CGA1-113 (vasostatin-2) forms. The 80-aa form (CGA1-80) stored in this card is a naturally occurring variant that contains the full vasostatin-1 sequence plus 4 additional C-terminal residues. The antimicrobial and cardiovascular activities demonstrated for CGA1-76 would be expected to be intact in the CGA1-80 form since the functional domains are contained within the first 76 aa. No study has specifically compared the 76-aa vs. 80-aa forms head-to-head.
Q: Why are chromogranin levels measured in clinical oncology? A: Chromogranin A (the CHGA precursor protein) is a well-established serum biomarker for neuroendocrine tumors (NETs), pheochromocytoma/paraganglioma, and neuroendocrine carcinomas. These tumors derive from neuroendocrine cells that store and secrete CHGA, and plasma CGA levels correlate with tumor burden and treatment response. While these clinical assays measure total CHGA protein (or specific epitopes), the vasostatin-1 and pancreastatin fragments are also generated from CHGA and can be measured as surrogate indicators of the same tumors. Clinical trials in NETs frequently include chromogranin A and its fragments as secondary biomarkers.
Related peptides
- Pancreastatin — the co-encoded CHGA-derived mid-region fragment; both vasostatin-1 and pancreastatin are derived from the same chromogranin A precursor and are measured together as neuroendocrine biomarkers
- ACTH / Corticotropin — another adrenal-linked peptide from a different precursor (POMC); co-activation of the HPA axis during stress parallels but is distinct from the chromaffin granule release of vasostatin-1
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Does vasostatin-1 work through its own dedicated receptor on heart cells, rather than just blocking adrenaline?
If true, this receptor could become a new drug target for people with stress-triggered heart problems or heart failure. It could lead to treatments that protect the heart during surges of adrenaline without broadly blocking the whole stress response.
When the body releases a surge of adrenaline, does not releasing enough vasostatin-1 at the same time cause the heart to be injured?
If true, patients in adrenaline crises (such as those with stress-induced heart failure or adrenaline-secreting tumors) could be treated with vasostatin-1 to protect the heart, filling a gap where no good treatment currently exists.
Can vasostatin-1 be split into two halves, one that calms the heart and one that fights microbes?
If the two functions sit in separate parts of the molecule, scientists could design shorter versions that do just one job, making safer and more precise medicines for heart conditions or infections.
If you chemically lock the active part of vasostatin-1 into a rigid helix, does it last long enough in the body to be a useful drug?
Most natural peptide hormones break down too fast in the bloodstream to be medicines. If stapling vasostatin-1 solves that problem, it could become an injectable drug to protect the heart during severe stress events, helping patients in intensive care or with adrenaline-secreting tumors.
Could vasostatin-1 help sepsis patients by both calming the heart stressed by the infection response and directly killing the infecting microbes?
Sepsis kills roughly one in five ICU patients, partly because adrenaline floods the body and partly because infection spirals out of control. If this single natural peptide addresses both problems, it could offer a new treatment angle where none currently exists.
Does vasostatin-1 kill harmful microbes at doses that leave human cells unharmed, better than existing peptide antibiotics?
If true, vasostatin-1 could be developed into a new antifungal or antibacterial treatment that is less toxic than current options, benefiting patients with difficult-to-treat fungal infections or resistant bacteria.
▸3-letter notation
▸citationbibtex
@peptide{pep04484,
sequence = {LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHS},
target = {},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}