pe
pep-04484 v1 CC-BY-SA-4.0

Vasostatin-1: heart-calming hormone released alongside adrenaline

A natural peptide released from the adrenal glands alongside adrenaline; slows heart force and rate, counters stress-driven blood-vessel tightening, and kills some bacteria and fungi. Not an approved drug, used as a research tool.

statusbioassayed target? length80 aa refs3
endogenous
status 2 / 5 · 0 verified on platform
sequence80 aa
15101520253035404550556065707580
LPVNSPMNKGDTEVMKCIVE VISDTLSKPSPMPVSQECFE TLRGDERILSILRHQNLLKE LQDLALQGAKERAHQQKKHS
overview readme

What this is

Vasostatin-1 is an 80-amino acid N-terminal fragment of chromogranin A (CHGA), a large acidic secretory protein stored in dense-core chromaffin granules of the adrenal medulla and co-secreted with catecholamines during adrenergic activation. It is classified as a chromogranin A-derived peptide — one of several biologically active fragments (others include pancreastatin, catestatin, and WE14) generated by proteolytic processing of the CHGA precursor. Vasostatin-1 exerts negative inotropic (reduced cardiac contractile force) and negative chronotropic (reduced heart rate) effects on the heart, blunts catecholamine-induced vasoconstriction, and possesses antimicrobial and antifungal activity. The stored sequence LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHS (80 aa) represents the CGA1-80 form; the most widely cited functional form in the literature is CGA1-76, which is fully contained within it — the 4 additional C-terminal residues (KKHS) reflect variability in processing-enzyme cut-site specificity and do not alter the known biological activities.

The name "vasostatin" was coined to reflect its vasoinhibitory properties — it opposes the vasoconstrictive and positive inotropic effects of catecholamines released simultaneously from chromaffin granules, functioning as an autocrine/paracrine brake on sympathoadrenal stimulation. Vasostatin-1 has no approved therapeutic use.


History

Chromogranin A was first characterized by Blaschko and colleagues in 1967 as a major soluble protein of bovine adrenal medullary chromaffin granules, where it is co-stored with epinephrine and norepinephrine. The full protein (457 aa) was recognized as a neuroendocrine marker and later shown to be proteolytically processed in vivo to yield multiple regulatory peptides.

The N-terminal fragment now called vasostatin-1 was characterized functionally by Aardal and Helle in 1992 using isolated heart preparations. That work demonstrated that a bovine chromogranin A N-terminal fragment (CGA1-76) inhibited cardiac contractility independent of extracellular calcium, establishing that CHGA-derived fragments could directly oppose catecholamine-induced stimulation — a novel autocrine regulatory concept. The fragment was named "vasostatin" to reflect its vasodilatory/vasoinhibitory properties (Aardal and Helle 1992).

Lugardon and colleagues at INSERM Strasbourg subsequently characterized the antimicrobial properties of vasostatin-1 in a 2000 paper in the Journal of Biological Chemistry, demonstrating potent bactericidal and fungicidal activity in the low micromolar range. That work established vasostatin-1 as a natural host-defense peptide with dual cardiovascular and antimicrobial roles — a function consistent with its release during the intense sympathoadrenal stress response when pathogen exposure risk is also elevated (Lugardon and colleagues 2000).

Subsequent work established that the structurally relevant antimicrobial core of vasostatin-1 lies in the C-terminal portion (approximately CGA47-76, termed "chromofungin"), while the cardiovascular regulatory effects involve the entire CGA1-76 domain through interactions with cardiac β-adrenergic signaling pathways.


What it does

Negative inotropic and chronotropic cardiac effects: Vasostatin-1 reduces myocardial contractile force (negative inotropy) and slows heart rate (negative chronotropy) in cardiac preparations. The mechanism involves modulation of β-adrenergic receptor signaling — vasostatin-1 attenuates the positive inotropic response to isoproterenol and reduces cAMP accumulation in cardiomyocytes. In the frog heart model, vasostatin-1 produces dose-dependent negative inotropic effects that are calcium-independent, suggesting a mechanism downstream of calcium entry involving cAMP-PKA signaling (Amato and colleagues 2005). These effects are particularly relevant during stress (fight-or-flight) responses when vasostatin-1 is co-released with the catecholamines it dampens.

Vasodilation and anti-vasoconstrictive activity: Vasostatin-1 opposes catecholamine-mediated vasoconstriction in vascular smooth muscle. The vasodilatory effect is partly endothelium-dependent (involves nitric oxide) but also has direct smooth muscle components. This counter-regulatory vascular activity complements the negative cardiac inotropic effect to create an overall dampening of sympathoadrenal cardiovascular stimulation.

Antimicrobial and antifungal activity: Vasostatin-1 kills gram-positive and gram-negative bacteria and a range of fungal species (including multiple Candida strains) at low micromolar concentrations in vitro. The antimicrobial activity is membrane-disruptive — vasostatin-1 adopts an amphiphilic structure in membrane-mimicking environments and permeabilizes bacterial and fungal cell membranes. The active antimicrobial core resides primarily in the C-terminal portion (CGA47-76, chromofungin) (Lugardon and colleagues 2000). This represents a plausible innate defense function: during acute stress-induced chromaffin granule exocytosis, vasostatin-1 is released alongside catecholamines at sites of potential infection or injury, providing local antimicrobial coverage.

Co-release with catecholamines: Vasostatin-1 is stored in the soluble compartment of adrenal medullary chromaffin granules and is quantitatively co-secreted with epinephrine upon stimulation of nicotinic acetylcholine receptors. Plasma vasostatin-1 levels rise measurably during acute stress and in conditions associated with sustained adrenergic activation (pheochromocytoma, heart failure). It thus functions as an endogenous feedback inhibitor of catecholamine action — part of the broader chromogranin "granulostatin" regulatory system.


Evidence

  • Human: No interventional trials with vasostatin-1 as a therapeutic agent have been published. Vasostatin-1 and chromogranin A-derived fragments are measured as biomarkers in human studies of neuroendocrine tumors, heart failure, and pheochromocytoma.
  • Animal: Negative inotropic and vasoinhibitory effects characterized in isolated perfused guinea-pig hearts (Aardal and Helle 1992) and in frog heart under pressure-overload conditions (Amato and colleagues 2005).
  • In vitro: Bactericidal activity against gram-positive organisms (Staphylococcus aureus, Listeria monocytogenes) and gram-negative organisms (Escherichia coli, Pseudomonas aeruginosa) and fungicidal activity against Candida albicans and Saccharomyces cerevisiae demonstrated in the low micromolar range (Lugardon and colleagues 2000).

Myths and misconceptions

  • "Vasostatin-1 is an inhibitor of the vasopressin system." The name "vasostatin" is sometimes interpreted as indicating a relationship to vasopressin (antidiuretic hormone/ADH) — it does not. "Vasostatin" derives from "vaso-" (referring to blood vessels/vasoconstriction) and the inhibitory suffix "-statin." Vasostatin-1 has no direct interaction with the vasopressin receptor or the renin-angiotensin-aldosterone axis; its cardiovascular actions are specifically anti-adrenergic.
  • "Vasostatin-1 is the same as chromofungin." Vasostatin-1 (CGA1-76 or CGA1-80) and chromofungin (CGA47-76) are different peptides. Chromofungin is the C-terminal subdomain of vasostatin-1, isolated as a smaller fragment with particularly potent antimicrobial activity. Vasostatin-1 contains the chromofungin sequence but also includes the N-terminal ~46 aa that contribute to its cardiovascular actions. Both peptides can be derived from the same vasostatin-1 precursor by additional processing.
  • "High vasostatin-1 plasma levels are specific to pheochromocytoma." Plasma chromogranin A (and its derived fragments including vasostatin-1) is elevated in multiple neuroendocrine tumors, in heart failure, in hypertension, in renal failure (due to impaired clearance), and with proton pump inhibitor use (which induces gastrin-chromogranin A axis activation). High plasma chromogranin-derived peptide levels require clinical context for interpretation; vasostatin-1 alone is not a specific pheochromocytoma marker.

Common questions

Q: How does vasostatin-1 function as a "brake" on catecholamine release? A: During acute stress, the adrenal medulla releases epinephrine and norepinephrine to increase heart rate, cardiac contractility, and peripheral vasoconstriction. Simultaneously, chromaffin granule exocytosis releases the soluble CHGA protein into circulation, where it is cleaved to produce vasostatin-1 among other fragments. Vasostatin-1 directly opposes catecholamine-induced positive inotropy at the cardiac level and blunts catecholamine-mediated vasoconstriction peripherally. This creates a feedback loop where the magnitude of adrenergic stimulation is partly self-limited by the CHGA-derived counter-regulatory fragments co-released with the catecholamines. This "granulostatin" auto-regulatory system represents a form of neuroendocrine autoregulation.

Q: Is the longer stored sequence (80 aa) functionally different from the classic CGA1-76 form? A: Published functional data on vasostatin variants focuses primarily on the CGA1-76 and CGA1-113 (vasostatin-2) forms. The 80-aa form (CGA1-80) stored in this card is a naturally occurring variant that contains the full vasostatin-1 sequence plus 4 additional C-terminal residues. The antimicrobial and cardiovascular activities demonstrated for CGA1-76 would be expected to be intact in the CGA1-80 form since the functional domains are contained within the first 76 aa. No study has specifically compared the 76-aa vs. 80-aa forms head-to-head.

Q: Why are chromogranin levels measured in clinical oncology? A: Chromogranin A (the CHGA precursor protein) is a well-established serum biomarker for neuroendocrine tumors (NETs), pheochromocytoma/paraganglioma, and neuroendocrine carcinomas. These tumors derive from neuroendocrine cells that store and secrete CHGA, and plasma CGA levels correlate with tumor burden and treatment response. While these clinical assays measure total CHGA protein (or specific epitopes), the vasostatin-1 and pancreastatin fragments are also generated from CHGA and can be measured as surrogate indicators of the same tumors. Clinical trials in NETs frequently include chromogranin A and its fragments as secondary biomarkers.


Related peptides

  • Pancreastatin — the co-encoded CHGA-derived mid-region fragment; both vasostatin-1 and pancreastatin are derived from the same chromogranin A precursor and are measured together as neuroendocrine biomarkers
  • ACTH / Corticotropin — another adrenal-linked peptide from a different precursor (POMC); co-activation of the HPA axis during stress parallels but is distinct from the chromaffin granule release of vasostatin-1
Hypotheses6 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does vasostatin-1 work through its own dedicated receptor on heart cells, rather than just blocking adrenaline?

If true, this receptor could become a new drug target for people with stress-triggered heart problems or heart failure. It could lead to treatments that protect the heart during surges of adrenaline without broadly blocking the whole stress response.

The hypothesis
Vasostatin-1 exerts its negative inotropic and chronotropic effects on cardiomyocytes primarily through a FPRL1/FPR2-independent, cAMP-suppressing pathway distinct from catestatin, involving direct interaction with a Gi-coupled receptor that is not the beta-adrenergic receptor itself.
Why it’s plausible
Chromogranin A-derived fragments differ structurally and functionally: catestatin inhibits nicotinic acetylcholine receptors and engages FPR2, while vasostatin-1 (CGA1-76/80) has a distinct N-terminal region enriched in acidic and polar residues (LPVNSPMNKGDT...) that is unlikely to activate formyl-peptide receptors. The negative inotropy of vasostatin-1 is preserved even when beta-adrenergic signaling is blocked, suggesting a parallel Gi-coupled receptor mechanism. No receptor has been conclusively identified for vasostatin-1, making this a genuine open question with therapeutic relevance.
Why it matters
Identifying the receptor would explain how the sympathoadrenal brake works at the molecular level and open a target for heart failure or stress-induced arrhythmia therapy.
Plausibility.70
Novelty.60
Impact.75
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Vasostatin-1 negative inotropic effects documented in cardiac preparations
doi: 10.1016/j.regpep.2005.03.004
[2]
sequenceN-terminal region LPVNSPMNKGDTEVMK is acidic/polar, unlike cationic FPR2-activating peptides such as catestatin
[3]
noteVasostatin-1 opposes catecholamine effects as autocrine/paracrine brake but receptor identity is unresolved
openupdated 2026-06-05

When the body releases a surge of adrenaline, does not releasing enough vasostatin-1 at the same time cause the heart to be injured?

If true, patients in adrenaline crises (such as those with stress-induced heart failure or adrenaline-secreting tumors) could be treated with vasostatin-1 to protect the heart, filling a gap where no good treatment currently exists.

The hypothesis
Endogenous vasostatin-1 plasma levels are inversely correlated with the severity of acute sympathoadrenal overstimulation syndromes (such as stress cardiomyopathy and catecholamine-induced cardiomyopathy), and insufficient vasostatin-1 co-secretion relative to catecholamines is a causal, not merely associative, contributor to pathological cardiac remodeling.
Why it’s plausible
Vasostatin-1 is co-stored with catecholamines and co-released during adrenergic activation, functioning as a built-in brake. In pathological states like Takotsubo cardiomyopathy or pheochromocytoma, catecholamine surges far exceed normal levels. If the vasostatin-1/catecholamine ratio falls below a critical threshold, the protective brake is overwhelmed, leading to direct catecholamine cardiotoxicity. This is mechanistically plausible but has not been established causally in human disease.
Why it matters
If causal, this would justify vasostatin-1 or a stable analog as an acute cardioprotective agent given during catecholamine crises, a currently unmet clinical need.
Plausibility.55
Novelty.70
Impact.80
Basis · grounding1 paper · 2 computed/notes
[1]
noteVasostatin-1 is co-secreted with catecholamines from chromaffin granules and acts as autocrine/paracrine brake on sympathoadrenal stimulation
[2]
paper
Negative inotropic and chronotropic effects of vasostatin-1 documented in cardiac systems
doi: 10.1016/j.regpep.2005.03.004
[3]
sequence80 aa peptide, no disulfide bond predicted from sequence (single C at position 17 and 39, unpaired), suggesting relatively labile structure that may limit plasma half-life
openupdated 2026-06-05

Can vasostatin-1 be split into two halves, one that calms the heart and one that fights microbes?

If the two functions sit in separate parts of the molecule, scientists could design shorter versions that do just one job, making safer and more precise medicines for heart conditions or infections.

The hypothesis
The segment spanning roughly residues 40-76 of vasostatin-1 (CFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKK) forms a transiently amphipathic alpha-helix that is the minimal cardiac-active domain, while the N-terminal disordered segment (residues 1-39) is dispensable for negative inotropy but required for antimicrobial membrane interaction.
Why it’s plausible
Inspection of the sequence reveals that residues ~42-76 contain a pattern of hydrophobic (L, I, L, L, L, A) and charged/polar (R, D, E, H, Q, K) residues consistent with a classical amphipathic helix. The N-terminal half (LPVNSPMNKGDTEVMK...) is rich in Pro, Asn, Ser, and Thr, which are helix-breakers and disorder-promoting, suggesting it stays unstructured. Cardiac negative inotropy and antimicrobial activity have distinct structural requirements in many dual-function peptides, and the known literature on CGA1-76 vs. shorter C-terminal fragments supports domain separation.
Why it matters
Defining the minimal active domain would enable engineering shorter, more manufacturable therapeutic peptides with separated cardiac vs. antimicrobial activities.
Plausibility.65
Novelty.60
Impact.70
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceResidues 42-76: CFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKK contain hydrophobic-charged alternation consistent with amphipathic helix; residues 1-39 contain P, N, S, T, M that disfavor helix formation
[2]
noteCGA1-76 is the most cited functional form; CGA1-80 C-terminal KKHS addition does not alter known activities, consistent with C-terminus being less critical than mid-segment
[3]
paper
Antimicrobial peptides often act through amphipathic helix-membrane interaction; dual cardiac/AMP function is noted for vasostatin-1
doi: 10.1074/jbc.275.15.10745
openupdated 2026-06-05

If you chemically lock the active part of vasostatin-1 into a rigid helix, does it last long enough in the body to be a useful drug?

Most natural peptide hormones break down too fast in the bloodstream to be medicines. If stapling vasostatin-1 solves that problem, it could become an injectable drug to protect the heart during severe stress events, helping patients in intensive care or with adrenaline-secreting tumors.

The hypothesis
Cyclization or stapling of the putative amphipathic helix region of vasostatin-1 (approximately residues 42-76) would increase proteolytic stability and helical content in plasma, substantially extending in vivo half-life and potency while preserving both cardiac and antimicrobial activities, making a stapled vasostatin-1 fragment a viable drug candidate.
Why it’s plausible
Native vasostatin-1 is an 80-residue linear peptide with no disulfide bonds evident from the sequence (the two Cys at positions 17 and 39 are separated by 22 residues with no strong pairing signal in a disordered context), making it susceptible to rapid proteolytic degradation in plasma. Hydrocarbon stapling or lactam bridging of the helical C-terminal segment would lock the helix, reduce protease accessibility, and potentially improve receptor engagement. This approach has been validated for other helical peptides (e.g., stapled BH3 helices, stapled GLP-1 analogs). The moderate charge of vasostatin-1's helical domain makes it a tractable stapling target without excessive aggregation risk.
Why it matters
Short plasma half-life is the primary barrier to therapeutic development of vasostatin-1; a stabilized fragment with retained dual activity would be a first-in-class candidate for cardiac protection in adrenergic crises.
Plausibility.60
Novelty.55
Impact.70
Basis · grounding3 computed/notes
[1]
sequenceTwo Cys residues at positions 17 (LPVNSPMNKGDTEVMK*C*IVEVISDTLSK) and 39 (VSQE*C*FETLRG) are separated by a long disordered linker; no classical disulfide bridge likely; linear peptide is protease-vulnerable
[2]
sequenceHelical region ~42-76 contains i, i+4 spacing of hydrophobic residues compatible with staple placement (e.g., L45, I49, L53 or similar)
[3]
noteVasostatin-1 has no approved therapeutic use; plasma stability is implicitly a barrier given it is a natural fragment of a larger secretory protein
openupdated 2026-06-05

Could vasostatin-1 help sepsis patients by both calming the heart stressed by the infection response and directly killing the infecting microbes?

Sepsis kills roughly one in five ICU patients, partly because adrenaline floods the body and partly because infection spirals out of control. If this single natural peptide addresses both problems, it could offer a new treatment angle where none currently exists.

The hypothesis
Vasostatin-1 or a stabilized analog could function as an adjunct in sepsis management by simultaneously suppressing the catecholamine-driven cardiac stress response and providing direct antimicrobial activity at infected tissue sites, addressing two independent drivers of sepsis mortality through a single endogenous molecule.
Why it’s plausible
Sepsis is characterized by both massive catecholamine release (causing cardiac dysfunction and vasoconstriction) and systemic infection requiring antimicrobial control. Vasostatin-1 has documented activity on both axes: negative inotropic/chronotropic cardiac effects and direct antimicrobial/antifungal activity. Current sepsis management uses vasopressors (which further stress the heart) and antibiotics separately. An endogenous peptide that counters catecholamine cardiotoxicity while directly targeting pathogens represents a biologically grounded dual-action concept that has not been formally tested in sepsis models.
Why it matters
Sepsis remains a leading cause of ICU mortality with no approved immunomodulatory therapy; a dual-action endogenous peptide represents a novel mechanistic approach.
Plausibility.45
Novelty.70
Impact.80
Basis · grounding2 papers · 1 computed/note
[1]
noteVasostatin-1 exerts negative inotropic/chronotropic cardiac effects AND possesses antimicrobial/antifungal activity, both relevant to sepsis pathophysiology
[2]
paper
Antimicrobial activity of chromogranin-derived peptides documented; storage in secretory granules suggests release at sites of infection/inflammation
doi: 10.1074/jbc.275.15.10745
[3]
paper
Vasostatin-1 blunts catecholamine-induced vasoconstriction and cardiac stress, the dominant hemodynamic crisis in septic shock
doi: 10.1016/j.regpep.2005.03.004
openupdated 2026-06-05

Does vasostatin-1 kill harmful microbes at doses that leave human cells unharmed, better than existing peptide antibiotics?

If true, vasostatin-1 could be developed into a new antifungal or antibacterial treatment that is less toxic than current options, benefiting patients with difficult-to-treat fungal infections or resistant bacteria.

The hypothesis
The antimicrobial activity of vasostatin-1 is selective for fungal and Gram-positive bacterial membranes over mammalian cell membranes due to the moderate net charge of its C-terminal helical domain, and this selectivity window is wider than that of classical highly cationic AMPs such as LL-37, making vasostatin-1 intrinsically less cytotoxic at bactericidal concentrations.
Why it’s plausible
Classical cationic AMPs like LL-37 achieve membrane disruption via strong electrostatic attraction to negatively charged bacterial lipids, but their high charge also causes mammalian cell toxicity at high doses. The sequence of vasostatin-1's putative helical domain (RILSILRHQNLLKELQDLALQGAKERAHQQKK) is only moderately cationic (several K, R residues but also D, E, Q residues reducing net charge), which may provide a wider therapeutic window. Antifungal and Gram-positive selectivity is consistent with its documented biological activities (README), and ergosterol- vs. cholesterol-containing membranes present distinct targets.
Why it matters
A broad-spectrum but low-cytotoxicity AMP scaffold would be highly valuable for topical or systemic antifungal/antibacterial development.
Plausibility.50
Novelty.45
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
sequencePutative helical region residues ~42-76 contain mixed charge: K, R (cationic) vs. D, E, Q (anionic/neutral), moderating net positive charge relative to LL-37
[2]
paper
Vasostatin-1 antimicrobial activity noted; context discusses AMPs stored in secretory granules and active at epithelial/infection-exposed sites
doi: 10.1074/jbc.275.15.10745
[3]
noteVasostatin-1 possesses antimicrobial and antifungal activity; no approved therapeutic use, suggesting selectivity window not yet fully characterized
details expand to inspect
3-letter notation
Leu-Pro-Val-Asn-Ser-Pro-Met-Asn-Lys-Gly-Asp-Thr-Glu-Val-Met-Lys-Cys-Ile-Val-Glu-Val-Ile-Ser-Asp-Thr-Leu-Ser-Lys-Pro-Ser-Pro-Met-Pro-Val-Ser-Gln-Glu-Cys-Phe-Glu-Thr-Leu-Arg-Gly-Asp-Glu-Arg-Ile-Leu-Ser-Ile-Leu-Arg-His-Gln-Asn-Leu-Leu-Lys-Glu-Leu-Gln-Asp-Leu-Ala-Leu-Gln-Gly-Ala-Lys-Glu-Arg-Ala-His-Gln-Gln-Lys-Lys-His-Ser
citationbibtex
peptidemodel (2026). Vasostatin-1: heart-calming hormone released alongside adrenaline (pep-04484, v1). PeptideModel. https://peptidemodel.com/card/pep-04484
@peptide{pep04484,
  sequence = {LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHS},
  target   = {},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
clinical trials 1 on ct.gov · checked 2026-05-22
ct.gov trials 1
PubMed reviews 1
by phase
1no phase
by status
1unknown
references 3 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use