The Y2 receptor (NPY2R) is a Gi-coupled GPCR that preferentially binds neuropeptide Y (NPY) and peptide YY (PYY) with high affinity. PYY(3–36) is a truncated form released postprandially with NPY2R selectivity that suppresses appetite via the gut–brain axis.
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY · 36 aa · @peptidemodel
| # | id | title | author | status | refs | metric | ♥ |
|---|---|---|---|---|---|---|---|
| 1 | pep-10604 | PYY(3-36): natural fullness hormone released after eating | pe@peptidemodel | 12 | — | 0 |
No discussion threads yet.