The most abundant protein in eukaryotic cells and the structural core of every muscle contraction, cell movement, and cytoskeletal reorganization. Thymosin β4 (TB-500) works by binding G-actin and preventing its polymerization, indirectly enabling tissue repair and angiogenesis. Six isoforms cover all tissue types; mutations cause nemaline myopathy, cardiomyopathy, and aortic aneurysm. Used for: muscle regeneration, cancer invasion research, cytoskeletal pharmacology.
Actin is the most abundant protein in eukaryotic cells and participates in more protein-protein interactions than any other known protein - making it both a fundamental cytoskeletal component and a high-value target for cancer, cytoskeletal disease, and drug delivery research. Six isoforms cover all tissue contexts: two cytoplasmic (β and γ) and four muscle-specific (α-skeletal, α-cardiac, α-smooth, γ-smooth). Mutations in ACTA1 (skeletal) cause nemaline myopathy; ACTC1 (cardiac) mutations underlie hypertrophic and dilated cardiomyopathy; ACTA2 (smooth muscle) variants cause aortic aneurysm and Moyamoya disease. Every scaffold targeting cell motility, muscle regeneration, or tumor invasion interfaces with this card.
G-actin is a 375-aa, 42 kDa monomer folded into four subdomains around a central nucleotide-binding cleft that binds ATP with Mg²⁺. Polymerization into F-actin is a right-handed two-start helix (2.75 nm rise/subunit, ~7–9 nm diameter), with a fast barbed end (Cc ~0.1 μM) and slow pointed end (Cc ~0.6 μM). ATP hydrolysis to ADP-Pi drives treadmilling: net addition at the barbed end, net loss at the pointed end. Over 150 actin-binding proteins (ABPs) tune these kinetics: Arp2/3 branches filaments; formins nucleate and processively elongate; cofilin severs ADP-actin; CapZ/tropomodulin cap ends; thymosin β4 sequesters monomers. In muscle, actin thin filaments slide against myosin thick filaments via the cross-bridge cycle - the direct mechanochemical engine of contraction. Nuclear actin (predominantly β-actin) participates in chromatin remodeling (INO80 complex), RNA Pol II recruitment, and pre-mRNA splicing.
No actin-targeting drug is approved for systemic use, but the research toolkit is deep. Latrunculin A (Kd ~0.2 μM) sequesters G-actin; cytochalasin D caps barbed ends (Kd ~2 nM); jasplakinolide stabilizes filaments and drives nucleation - all are standard research tools for dissecting actin-dependent phenotypes. Phalloidin-FITC is the canonical F-actin imaging probe; Lifeact (17-aa peptide) is the live-cell equivalent. AAV-ACTA1 gene therapy is in preclinical development for ACTA1-nemaline myopathy. For peptide research, the tractable recipes are: thymosin β4 analogs and truncated fragments (Tβ4 is itself a 43-aa naturally occurring peptide with wound-healing and cardioprotective effects in clinical trials); Lifeact-derived peptides as intracellular actin probes; and barbed-end-binding cyclic peptides modeled on cytochalasin contacts to block invadopodia in metastatic cancer. Actin-targeted nanoparticle platforms conjugated to antibody or peptide ligands also represent an active delivery scaffold for tumor targeting.
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES · 43 aa · @peptidemodel
| # | id | title | author | status | refs | ipSAE_d0chn | ♥ |
|---|---|---|---|---|---|---|---|
| 1 | pep-00013 | TB-500 (Thymosin Beta-4): experimental tissue-repair peptide | pe@peptidemodel | 2 | — | 0 |
No discussion threads yet.