pe
pep-04441 v1 CC-BY-SA-4.0
151015202530354044
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Tesamorelin — HIV-associated lipodystrophy

GHRH analog — FDA-approved for HIV-associated lipodystrophy

status bioassayed target GHRHR length 44 aa refs 1
fda-approvedreference-scaffold
status 5 / 5 · 2 contributors
prediction metrics boltz-2 1.0
ipTM0.830
pTM0.872
avg pLDDT79.2
ranking score0.799
overview readme

Snapshot

Class: GHRH analog (synthetic)
Evidence tier: Approved drug
Status: FDA-approved prescription drug (HIV-associated lipodystrophy); Health Canada-approved; EMA marketing authorization withdrawn by sponsor
Best-supported effect: Visceral adipose tissue reduction (~15–18%) in adults with HIV-associated lipodystrophy, established by Phase III RCTs and confirmed at 52 weeks; with human evidence for hepatic fat reduction and exploratory human evidence for cognitive outcomes in people with HIV
Main caveat: Approved indication is narrow and population-specific — dedicated RCTs in healthy aging adults or non-HIV populations do not exist; visceral fat benefit is treatment-dependent and reverses after discontinuation


What this is

Tesamorelin is a synthetic 44-amino-acid analog of human growth hormone-releasing hormone (GHRH), modified at the N-terminus with a trans-3-hexenoyl group. This modification protects the peptide from rapid cleavage by dipeptidyl peptidase IV (DPP-IV), extending its half-life and making once-daily dosing clinically viable. The underlying GHRH sequence was characterized in the 1980s; Theratechnologies (Montreal) developed the stabilizing modification and completed the clinical program.

The FDA approved tesamorelin in November 2010 under the brand name Egrifta, specifically for reducing excess abdominal fat in HIV-infected patients with lipodystrophy — a disfiguring metabolic complication of antiretroviral therapy. It is the only GHRH analog to have cleared full FDA approval; an earlier approval for sermorelin (GHRH fragment 1–29) was withdrawn in 2008.

Tesamorelin works by stimulating pulsatile growth hormone release from the pituitary, driving downstream IGF-1 production and selective visceral adipose tissue mobilization. Its distinctive feature is preserving the body's natural GH feedback mechanisms rather than replacing the hormone directly. The approved evidence base is anchored in the HIV-lipodystrophy population; off-label use in broader metabolic and anti-aging contexts is widespread but is not supported by the approved clinical program.


Evidence map

Evidence layerGradeWhat it supports
HumanApproved (Phase III)Visceral fat reduction in HIV-associated lipodystrophy — two pivotal RCTs (n=816 pooled); 52-week extension confirms durability of benefit during treatment. Secondary: hepatic fat reduction, lipid improvement, and lean mass preservation in the HIV-lipodystrophy population. Exploratory human RCT evidence for cognitive outcomes and neurocognitive function in people with HIV. No controlled evidence in healthy aging adults or general obesity.
AnimalModerate (preclinical program)available literature describes a comprehensive preclinical development program; detailed individual animal study data are not individually extracted.
In vitroNot individually extractedavailable literature covers receptor binding and mechanistic characterization; individual assay data are not separately extracted in this card.
ComputationalNone identifiedNo platform prediction or docking data attached.
MechanismStrongWell-characterized GHRH receptor agonism; cAMP/PKA pathway; pulsatile GH secretion; downstream IGF-1-mediated lipolysis in visceral adipose tissue. Mechanistic basis is consistent with the approved clinical effect.

Claim check

ClaimVerdictEvidence layerConfidence
Reduces visceral adipose tissue in adults with HIV-associated lipodystrophySupportedHuman Phase III / approved labelHigh
Does not reduce subcutaneous fat — effect is visceral-selectiveSupportedHuman Phase III / approved labelHigh
Works as a general weight-loss drug or for fat loss in healthy adultsContradicted / not establishedHuman label and trialsHigh
Improves cognitive functionPartially supported — human exploratoryHuman Phase II (HIV population with neurocognitive impairment)Low — small controlled trials in specific population; not established in healthy aging adults
Reduces hepatic fat (NASH/NAFLD context)Partially supported — human RCT, HIV populationHuman RCTs (HIV-positive patients with hepatic steatosis)Medium — controlled evidence in HIV population; non-HIV generalization not established
Benefit is permanent — visceral fat loss is sustained after stoppingContradictedHuman Phase III extensionHigh — discontinuation data show VAT regresses; benefit is treatment-dependent
Safe and appropriate for anti-aging use in healthy adultsNot establishedHuman (no dedicated RCTs in this population)High — off-label use exists; controlled evidence does not
Long-term cardiovascular safety is establishedNot establishedHuman (label limitation)High — FDA label explicitly states long-term cardiovascular safety is not known; trial window was 26–52 weeks

Exposure studied

This section reports exposure used in approved labels and human studies. It is not a personalized protocol.

ContextPopulationExposure studiedDurationEndpointEvidence strengthLimitation
FDA label — Egrifta SV (F1/F4 formulation)Adults with HIV-associated lipodystrophy2 mg subcutaneous once dailyApproved for continuous use; Phase III primary endpoint at 26 weeks, extension to 52 weeksCT-measured visceral adipose tissue reductionApproved label / Phase III RCTApproved indication only; off-label use is not covered by this labeling
FDA label — Egrifta WR (F8 formulation, approved March 2025)Adults with HIV-associated lipodystrophy1.28 mg subcutaneous once daily (0.16 mL from 11.6 mg weekly-reconstituted vial)Continuous; weekly reconstitutionCT-measured visceral adipose tissue reductionApproved label — bioequivalence demonstratedReformulation; daily injection continues; approved indication unchanged
Phase III pivotal trials (LIPO-010 and LIPO-011)HIV-infected adults with abdominal fat accumulation (n=816 pooled)2 mg subcutaneous once daily26 weeks (main phase) + 26-week extensionCT-measured VAT, trunk fat, lipid profilesPhase III RCTsPopulation-specific; no comparator arm against other metabolic therapies
Phase II RCT — cognitive functionAdults with HIV and abdominal obesity / neurocognitive impairment2 mg subcutaneous once daily20–26 weeksExecutive function composite, verbal memoryPhase II randomized controlled trialSmall; specific HIV population; not established in healthy aging adults
RCT — hepatic fat / NAFLD in HIVHIV-positive patients with hepatic fat accumulation2 mg subcutaneous once daily6 monthsLiver fat by MRS, ALT, fibrosis markersRandomized controlled trialHIV population; non-HIV liver disease extrapolation not established

Safety signals

SignalEvidence contextNotes
Injection-site reactions (erythema, pruritus, pain, induration)Label / Phase III trialsReported in 8–13% of trial participants; most common adverse event; rarely led to discontinuation
Arthralgia and myalgia (joint and muscle pain)Label / Phase III trialsCommon; dose-related; described as generally mild to moderate and typically diminishing with continued treatment
Peripheral edema (fluid retention)Label / Phase III trialsRelated to GH-axis activation; class effect
Glucose intolerance and HbA1c elevationLabel / Phase III trialsGH antagonizes insulin action; monitoring of glucose and HbA1c is built into the approved prescribing information
IGF-1 elevation above normal rangeLabel / Phase III trialsExpected pharmacodynamic effect; persistent supraphysiological IGF-1 is a monitoring concern given theoretical cancer-risk implications of chronically elevated IGF-1
Carpal tunnel-like symptoms and paresthesiasLabel / trialsReported; class effect of GH/IGF-1 elevation; generally mild
Hypersensitivity reactions (urticaria, rash, anaphylaxis)LabelRare; includes serious reactions; contraindicated in known hypersensitivity to tesamorelin or mannitol excipient
Long-term cardiovascular outcomesLabel limitationFDA label explicitly states long-term cardiovascular safety is not known; no dedicated cardiovascular endpoint trial; a mandated 10-year post-marketing cohort study tracking MACE, malignancy, type 2 diabetes, and retinopathy in HIV-lipodystrophy patients is ongoing but has not fully reported

Label contraindications (per available sources):

  • Active malignancy — GH/IGF-1 elevation may accelerate existing tumor proliferation; contraindicated per label
  • Disrupted hypothalamic-pituitary axis (hypophysectomy, hypopituitarism, pituitary tumor or surgery, head irradiation, head trauma) — pharmacological effect requires intact somatotroph axis
  • Pregnancy — contraindicated per approved label; pharmacologic GH/IGF-1 effects not characterized in reproductive-toxicology studies adequate to support use
  • Known hypersensitivity to tesamorelin or mannitol

Interaction signals (per available sources): available literature describes interactions with glucose-regulating agents (insulin, sulfonylureas, GLP-1 receptor agonists) based on GH's counter-regulatory effect on glucose; dose adjustment of antidiabetic agents may be relevant during treatment and is reflected in the prescribing information. available literature also notes that corticosteroids may blunt GH secretion at the pituitary level and attenuate clinical effect. Controlled interaction data beyond these class-level descriptions are not individually extracted.


Regulatory status

Region / bodyStatusNotes
US (FDA)Approved prescription drugApproved November 2010; brand names Egrifta (original), Egrifta SV (2014), Egrifta WR (March 2025). Approved indication: reduction of excess abdominal fat in HIV-infected patients with lipodystrophy. Label states: not for weight loss management. Prescription-only; specialty pharmacy distribution. No generic (orphan drug economics).
Canada (Health Canada)Approved prescription drugApproved under HIV-lipodystrophy indication; same manufacturer
EU (EMA)Marketing authorization withdrawnEMA initially authorized tesamorelin (Egrifta) in 2014; marketing authorization was subsequently withdrawn by the sponsor. Current EU status requires verification against the current EMA register.
WADAProhibited at all timesS2 category — Peptide Hormones, Growth Factors, Related Substances and Mimetics; covers GHRH and its analogs; prohibited both in and out of competition. A Therapeutic Use Exemption process exists for athletes with documented medical need; FDA-approved status does not provide automatic exemption. per available sources as of April 2026; current WADA list status should be verified against the current prohibited list.
Compounding (US)RestrictedPer available sources, 503A compounding is restricted; compounding status requires verification against current FDA bulk-substance list and enforcement context — not individually confirmed in this card.

Clinical trials

Key trials from the available literature bundle. Additional published trials are listed in References.

Trial / sourcePhasePopulationPrimary endpointStatus / result
LIPO-010 — Falutz et al. 2007Phase IIIHIV-infected adults with lipodystrophy (n=412)CT-measured visceral adipose tissue at 26 weeksCompleted — 15.2% VAT reduction vs 5.0% placebo; basis for FDA approval
LIPO-011 pooled analysis — Falutz et al. 2010Phase IIIHIV-infected adults with lipodystrophy (n=816 pooled)CT-measured VAT; 52-week extensionCompleted — confirmed 15–18% VAT reduction; extension showed sustained benefit during treatment; fat regressed after stopping
Stanley et al. 2014 — hepatic fat / NAFLDNot individually extractedHIV-positive patients with abdominal fat accumulation and hepatic steatosis (n=50)Liver fat by MRS, hepatic outcomesCompleted — hepatic fat reduction documented as secondary outcome
Stanley et al. 2019 — NAFLD multicentre RCTPhase II (RCT)HIV-positive patients with NAFLDLiver fatCompleted — published in Lancet HIV
Fourman et al. 2020 — cognitive function ( per PE source; Annals of Internal Medicine 2020:172)Randomized controlled trialOlder adults with mild cognitive impairment (non-HIV population per PE source)Executive function compositeCompleted — improvement in executive function scores; effects correlated with IGF-1 increases; exploratory
Ances et al. 2024 / 2025 — neurocognitive impairment in people with HIVPhase IIVirally suppressed people with HIV and abdominal obesityNeurocognitive impairment endpointsCompleted (2025 publication) — extended tesamorelin evidence beyond visceral fat; specific results not individually extracted

Last checked: available literature bundle dated April 2026. Total registered trials: not individually enumerated in this card.


Mechanism

Tesamorelin acts as a full agonist at the growth hormone-releasing hormone receptor (GHRH-R) on somatotroph cells in the anterior pituitary gland. Despite the N-terminal trans-3-hexenoyl modification — which sterically protects the peptide from DPP-IV cleavage and extends its plasma half-life to approximately 26–38 minutes after subcutaneous injection — the peptide retains full agonist activity at GHRH-R.

GHRH-R activation triggers the cAMP/PKA signaling cascade, stimulating synthesis and secretion of growth hormone. A key mechanistic feature of tesamorelin versus exogenous GH injection is that GH secretion remains pulsatile: normal negative feedback through somatostatin and IGF-1 remains intact, preventing supraphysiological sustained GH elevation. The resulting rise in circulating GH drives IGF-1 production in the liver, and IGF-1 is the primary downstream mediator of visceral adipose tissue lipolysis. GH receptors are more densely expressed in visceral adipose tissue than in subcutaneous fat, providing a mechanistic basis for the observed selectivity of tesamorelin's fat-mobilizing effect.

Target note: available literature consistently identifies GHRH-R (the growth hormone-releasing hormone receptor) as the primary target. An earlier data import assigned this compound to GHSR (the ghrelin receptor); this is incorrect — tesamorelin acts at GHRH-R, not GHSR. The GHRH-R target is well-characterized and is the basis for FDA approval.


Chemistry

FieldValue
Amino-acid chainYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Length44 amino acids
TopologyLinear
ModificationN-terminal trans-3-hexenoyl (trans-3-hexenoic acid) group conjugated to the N-terminal tyrosine residue at position 1
Modification purposeSteric protection from DPP-IV cleavage; extends half-life; preserves GHRH-R agonist activity
Molecular weight~5135.8 Da (5135 Da)
Molecular formulaC₂₂₁H₃₆₆N₆₈O₆₇S
CAS901758-09-6
Half-life~26–38 minutes (subcutaneous)
Sequence confidenceNeeds review — two source sections list the sequence as YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues); one internal annotation references QQGEESNQE vs QQGESNQE; the sequence above is from the RP source which lists 44 residues, consistent with the stated AA count. Both the PE and RP sections give essentially the same sequence; the QQGE/QQGEE discrepancy is noted in the spec as a known conflict. Verification against a primary chemistry source (Uniprot, DrugBank, or FDA label sequence) is recommended before finalizing.
Salt formNot specified in available literature
OriginTheratechnologies Inc. (Montreal, Canada); developed from endogenous human GHRH(1–44)

Open questions

  • Long-term cardiovascular safety: The FDA label explicitly states that long-term cardiovascular safety is not known. A mandated 10-year post-marketing cohort study tracking MACE, malignancy, type 2 diabetes, and retinopathy in the HIV-lipodystrophy population is ongoing but has not fully reported. Cardiovascular endpoint data are currently limited to metabolic-marker improvements from trial windows of 26–52 weeks.
  • Efficacy and safety in healthy aging adults: The dominant off-label use case — body recomposition in men 40+ without HIV — has not been tested in dedicated RCTs. The Baker / Fourman cognitive impairment work is an exception but involved small populations with specific clinical characteristics. Mechanism-based extrapolation from the HIV-lipodystrophy trials to healthy aging adults involves a substantial inference gap.
  • Durability of benefit in off-label populations: Regression of visceral fat after discontinuation is well-characterized in the HIV-lipodystrophy population. Whether this pattern holds similarly, more strongly, or differently in non-HIV populations receiving off-label treatment has not been studied.
  • Non-HIV NAFLD/NASH hard endpoints: Hepatic fat reduction in HIV-positive patients with steatosis is documented. Whether these effects translate to hard liver endpoints (fibrosis progression, hepatocellular carcinoma incidence) in populations without HIV coinfection has not been established.
  • Neurocognitive outcomes: Early Phase II data in people with HIV and abdominal obesity suggest a neurocognitive signal. The mechanistic basis is plausible (IGF-1 promotes neurogenesis and synaptic plasticity), but the evidence remains preliminary and population-specific. Replication in non-HIV populations and in larger trials is needed.
  • Sequence verification: Source sections show minor discrepancy in the QQGE/QQGEE region. Verification against a primary chemistry authority (FDA label sequence, DrugBank, Uniprot) is recommended.
  • Comparative effectiveness: No controlled data compare tesamorelin against newer GLP-1 receptor agonists or other metabolic therapies for visceral fat reduction in non-HIV populations with general visceral adiposity.
STRUCTURE · PEP-04441 × GHRHR
ranking0.799
target interface 4.5Å peptide drag rotate · scroll zoom · right-click pan
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8295246958732605 boltz-2
ranking score 0.7991945147514343 boltz-2
structural qualityopenfold3
metricvaluenote
gpde0.710global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). Tesamorelin — HIV-associated lipodystrophy (pep-04441, v1). PeptideModel. https://peptidemodel.com/card/pep-04441
@peptide{pep04441,
  sequence = {YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL},
  target   = {ghrhr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
references 1 papers
[1]
Vaughan, J. et al. 1992 Neuroendocrinology Neuroendocrinology 1992;56:539-549
supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use