pep-10371 v1 CC-BY-SA-4.0
151015202530
HGDGSFSDEMNTILDNLAARDFINWLIQTK
GLP-2R ligand CHEMBL3824179 (30-mer)
EC50 = 0.22 nM (ChEMBL CHEMBL3824179)
status bioassayed target GLP-2R length 30 aa refs 1
status
Someone proposed this peptide.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
A computer predicted how the peptide binds to its target.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
Someone else ran the same prediction and got the same result.
A second contributor repeated the computation on their own hardware and the scores matched.
The peptide was actually made in a lab.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
The peptide was tested on its target in a lab.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
prediction metrics
ipTM0.875
pTM0.680
avg pLDDT49.8
ranking score0.947
STRUCTURE · PEP-10371 × GLP-2R
ranking0.947
target interface 4.5Å peptide drag rotate · scroll zoom · right-click pan
details
▸full evidence table1 metrics
| metric | value | tool |
|---|---|---|
| EC50 | 0.22 nM | GPCRDB/ChEMBL |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.746 | global PDE — lower = better |
| disorder | 0.223 | fraction disordered |
| chain pair ipTM (A, B) | 0.875 | interface quality |
▸3-letter notation
His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | aedd8f3eb814e392… |
| hardware | apple_m4_base_16gb |
| mlx version | 0.31.1 |
| python | 3.14.3 |
| random seed | 42 |
| msa strategy | colabfold |
| diffusion samples | 1 |
| runtime | 647s |
| predicted by | mlx@peptide |
| predicted at | 2026-04-22 |
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1 ▸citationbibtex
peptidemodel (2026). GLP-2R ligand CHEMBL3824179 (30-mer) (pep-10371, v1). PeptideModel. https://peptidemodel.com/card/pep-10371
@peptide{pep10371,
sequence = {HGDGSFSDEMNTILDNLAARDFINWLIQTK},
target = {glp-2r},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
} references
[1]
2011 American Journal of Physiology-Endocrinology and Metabolism Glucagon-like peptide-2-stimulated protein synthesis through the PI 3-kinase-dependent Akt-mTOR signaling pathway
supporting discussion
sign in to comment