pe
pep-10687 v1 CC-BY-SA-4.0

Neuropeptide W-30: brain peptide controlling appetite, stress & pain

A 30-amino-acid brain signaling peptide, found naturally in pigs, that helps regulate hunger, the body's hormonal stress response, and pain processing; used only as a lab research tool.

statussynthesized targetNPBWR1 length30 aa refs7
status 4 / 5
prediction metrics boltz-2 2.2.1
ipTM0.726
pTM0.872
avg pLDDT82.6
ranking score0.806
STRUCTURE · PEP-10687 × NPBWR1
ranking0.806
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 2.2.1 · mmCIF ↓ download
sequence30 aa
151015202530
WYKHTASPRYHTVGR AAGLLMGLRRSPYMW
overview readme

What this is

Neuropeptide W-30 (NPW-30) is a 30-amino-acid signaling peptide found in the brain that acts on a receptor called NPBWR1 (also known as GPR7). It belongs to a small family of neuropeptides — alongside its shorter sibling NPW-23 and the related Neuropeptide B — that were identified in the early 2000s as the natural activators of two previously "orphan" receptors whose functions were unknown. NPW is produced mainly in specific neurons of the hypothalamus, midbrain, and amygdala, and it plays roles in controlling appetite, the body's hormonal stress response, and the processing of pain and fear. The sequence stored here is the porcine (pig) form of NPW-30, which was the form first purified from brain tissue and used to characterise the NPBWR1 receptor; the human and rat sequences are nearly identical in the NPW-23 region but differ slightly in the seven C-terminal residues unique to the -30 form.

History

NPW-30 and NPW-23 were simultaneously discovered in 2002 by Shimomura and colleagues, who purified both peptide forms from porcine hypothalamic extracts by monitoring their ability to suppress cAMP production in Chinese hamster ovary cells engineered to express the human GPR8 receptor (Shimomura et al., Journal of Biological Chemistry, 2002). The discovery resolved a decade-long puzzle: GPR7 and GPR8 (later renamed NPBWR1 and NPBWR2) had been cloned in the 1990s and were structurally related to opioid and somatostatin receptors, but their natural activating ligands — their endogenous agonists — were unknown. In the same year a second group independently characterised the same peptide family, confirming the ligand assignment. The name "Neuropeptide W" reflects the tryptophan (single-letter code W) residues that appear at both the N-terminal and C-terminal ends of the mature peptide. Subsequent work by Mondal and colleagues (2003) established a role in feeding regulation, and Baker and colleagues (2003) mapped NPW's effects on the hormonal stress axis. Comprehensive reviews of the receptor biology and physiological roles were published through the 2010s as knockout mouse models clarified the system's functions in energy balance, pain, and emotional behaviour (Sakurai, Frontiers in Endocrinology, 2013; Chottova Dvorakova, Frontiers in Physiology, 2018).

What it does

NPW-30 activates NPBWR1 (and to some degree NPBWR2) in the hypothalamus and limbic brain to influence three main areas: energy balance, the hormonal response to stress, and the modulation of pain and fear.

On energy balance, central administration of NPW influences feeding in a pattern that depends on circadian phase and nutritional state — suppressing food intake under some conditions. Mice lacking NPBWR1 develop progressive adult-onset obesity driven by overeating and reduced energy expenditure, establishing that the receptor is required for normal long-term energy homeostasis (Mondal et al., Endocrinology, 2003).

On the stress axis, NPW acts in the hypothalamus to indirectly raise cortisol and ACTH by stimulating corticotropin-releasing factor (CRF) neurons in the paraventricular nucleus — it does not act directly on the pituitary. Baker and colleagues (2003) showed that central NPW injection dose-dependently elevated plasma prolactin and corticosterone while lowering growth hormone in conscious rats, with effects apparent at a 1 nanomole threshold dose. A CRF receptor antagonist blocked the corticosterone response, confirming the indirect route (Baker et al., Endocrinology, 2003).

On pain and emotion, NPW and its receptor are expressed densely in the periaqueductal gray (pain gating) and in the central amygdala and bed nucleus of the stria terminalis (fear and anxiety circuits). Nagata-Kuroiwa and colleagues (2011) showed that NPBWR1-knockout mice display impaired contextual fear conditioning and altered social behaviour, supporting a role for this receptor system in fear memory and social processing (Nagata-Kuroiwa et al., PLoS ONE, 2011).

Evidence

  • Human: No clinical trials of NPW-30 have been conducted. Human evidence is limited to expression studies and genetic data: a single-nucleotide polymorphism in NPBWR1 (the 404A>T variant causing a Y135F substitution) was associated with differences in how carriers perceive emotional facial expressions (Watanabe et al., PLoS ONE, 2012). Human mRNA expression studies confirm NPW is present in the substantia nigra, amygdala, and hippocampus (Singh et al., British Journal of Pharmacology, 2006).
  • Animal: Multiple rodent studies document NPW's effects on feeding, neuroendocrine function, pain, and fear. NPBWR1-knockout mice develop adult-onset obesity. Central NPW injection in rats elevates corticosterone and prolactin while suppressing growth hormone (Baker et al. 2003; Mondal et al. 2003). Intrathecal NPW reduced inflammatory pain behaviours in rats, an effect not blocked by naloxone, indicating non-opioid analgesia (reviewed in Sakurai, Frontiers in Endocrinology, 2013).
  • In vitro: NPW-30 and NPW-23 bind NPBWR1 and NPBWR2 in receptor-expressing cell lines, inhibiting forskolin-stimulated cAMP production through Gi/o protein coupling. NPW-23 shows slightly higher potency at both receptors than NPW-30 (Shimomura et al. 2002). Human adrenocortical cells expressing both receptor subtypes respond to NPW with increased cortisol secretion through both adenylate cyclase and phospholipase C pathways.

Known effects

  • Appetite modulation — Preclinical (central administration in rodents suppresses feeding; NPBWR1 knockout causes hyperphagia and obesity)
  • HPA axis activation — Preclinical (elevates corticosterone and ACTH via CRF-dependent pathway)
  • Prolactin stimulation — Preclinical (central injection in rats)
  • Growth hormone suppression — Preclinical (central injection in rats, via arcuate somatostatin neurons)
  • Inflammatory pain modulation — Preclinical (intrathecal administration reduced pain behaviours in rodent models, non-opioid mechanism)
  • Fear memory and social behaviour — Preclinical (receptor knockout models in mice)
  • Thermogenesis — Preclinical (NPW increases body temperature and oxygen consumption in rats)

Mechanism

NPW-30 activates NPBWR1 (and, with somewhat lower potency, NPBWR2), which are class A GPCRs that couple to heterotrimeric Gi/o proteins. The primary intracellular signal is inhibition of adenylate cyclase and suppression of cAMP; activation of phospholipase C-dependent cascades has also been documented in human adrenocortical cells. In hypothalamic circuits, NPW depolarises paraventricular nucleus neurons and engages corticotropin-releasing factor (CRF) interneurons to drive the HPA stress response rather than acting directly on the pituitary. In the arcuate nucleus, NPW modulates the balance between anorexigenic POMC neurons and orexigenic NPY neurons. In limbic structures — particularly the central amygdala and bed nucleus of the stria terminalis, where NPBWR1 is most densely expressed — NPW likely regulates emotional salience and fear learning. A notable species constraint: NPBWR2 (GPR8) is absent in rodents but present in humans, meaning studies in rats and mice cannot capture the full receptor pharmacology of the human NPW system (Singh et al., British Journal of Pharmacology, 2006; Sakurai, Frontiers in Endocrinology, 2013).

Safety signals

No human safety data exist for NPW-30 as an exogenous compound. All available information comes from animal pharmacology. Rodent studies using central (intracerebroventricular) or intrathecal administration have not reported acute toxicity at the doses used, but these routes are experimental and the findings cannot be extrapolated to systemic use in humans. NPBWR1-knockout mice are viable and fertile, though they develop metabolic and behavioural phenotypes with age.

Regulatory status

  • US / EU: Not approved, not in clinical development. Research-use compound only.
  • WADA: Not specifically listed; no competitive athletic application identified in published literature.
  • ClinicalTrials.gov: No registered trials for Neuropeptide W-30 or the NPW/NPBWR system as of June 2026.

Related peptides

  • Neuropeptide W-23 — the 23-residue N-terminal fragment of NPW-30 and the more potent activator of NPBWR1/NPBWR2; the predominant form used in most receptor characterisation studies.
  • Neuropeptide B (NPB) — the closely related sister peptide that preferentially activates NPBWR1 and shares overlapping roles in energy balance and pain; NPB-knockout mice develop mild adult-onset obesity.
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7258952260017395 boltz-2
ranking score 0.8060116767883301 boltz-2
3-letter notation
Trp-Tyr-Lys-His-Thr-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Met-Trp
recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights
hardwarevast_v100_32gb
mlx version
python
random seed1
msa strategycolabfold_local
runtime
predicted by
predicted at2026-05-22
citationbibtex
peptidemodel (2026). Neuropeptide W-30: brain peptide controlling appetite, stress & pain (pep-10687, v1). PeptideModel. https://peptidemodel.com/card/pep-10687
@peptide{pep10687,
  sequence = {WYKHTASPRYHTVGRAAGLLMGLRRSPYMW},
  target   = {npbwr1},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 1 by signal overlap
clinical trials 0 trials · checked 2026-05-09
0
no registered clinical trials as of 2026-05-09; we'll re-check periodically
references 7 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use