pe
pep-10659 v1 CC-BY-SA-4.0

Prolactin-releasing peptide: brain signal for appetite, stress & prolactin (PrRP31)

A natural brain hormone that helps regulate appetite, the stress response, and the release of prolactin from the pituitary gland; used as a lab research tool.

statussynthesized targetGNRHR length31 aa refs1
status 4 / 5
prediction metrics boltz-2 1.0
ipTM0.664
pTM0.821
avg pLDDT71.4
ranking score0.704
STRUCTURE · PEP-10659 × GNRHR
ranking0.704
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence31 aa
15101520253031
SRTHRHSMEIRTPDIN PAWYASRGIRPVGRF
in the news 3 articles
overview readme

What this is

Prolactin-releasing peptide (PrRP) is a neuropeptide produced in the brain that the body uses to regulate appetite, the stress response, and — as its name suggests — the release of prolactin from the pituitary gland. It exists in two natural isoforms processed from the same precursor protein: a 31-amino-acid form (PrRP31) and a shorter 20-amino-acid form (PrRP20); both share an identical C-terminal sequence and similar potency at their receptor (Langmead and colleagues, 2000). PrRP31 was first isolated from bovine hypothalamus in 1998 when Hinuma and colleagues identified it as the endogenous ligand for an orphan G-protein-coupled receptor then called hGR3, now designated GPR10 (Hinuma and colleagues, 1998).

History

PrRP was discovered in 1998 by Hinuma and colleagues at Takeda Chemical Industries (Japan), reported in Nature, using an orphan receptor deorphanization strategy: they screened hypothalamic extracts for peptides that could activate arachidonic-acid release from cells stably expressing the orphan receptor hGR3/GPR10 (Hinuma and colleagues, 1998). The name "prolactin-releasing peptide" reflected the original observation that the peptide stimulated prolactin secretion from anterior pituitary cells, though subsequent work established that its potency for prolactin release was considerably lower than that of thyrotropin-releasing hormone (TRH) — making energy homeostasis and stress signaling its more prominent physiological roles. By the time a 2008 review by Lin summarized the field, more than 120 papers had been published on the PrRP system, spanning its roles in anxiety, pain, homeostatic regulation, and stress physiology.

What it does

PrRP31 acts primarily in the brainstem and hypothalamus to suppress food intake and modulate the body's stress response. Neurons in the nucleus of the solitary tract (NTS) — a region in the brainstem that receives gut and visceral signals — are the main source of PrRP in the brain, and they project to appetite-regulating centers in the hypothalamus including the paraventricular nucleus (PVN). Central administration of PrRP31 reduces food intake in both fasted and free-fed rats, and loss of GPR10 signaling leads to late-onset hyperphagia, increased body fat, and obesity in mice (Pražienková and colleagues, 2019). Beyond feeding, PrRP31 activates HPA-axis stress circuits: it stimulates CRH neurons in the PVN and drives corticosterone and ACTH release, positioning PrRP neurons as an upstream relay that transmits visceral stress signals toward the brain's endocrine command center. PrRP also modulates sleep and mood circuits: brainstem PrRP neurons inhibit melanin-concentrating hormone (MCH) neurons in the lateral hypothalamus via GABA-mediated mechanisms, and impaired PrRP signaling has been associated with stress-related coping failure in animal models (Vas and colleagues, 2023).

Evidence

  • Human: No human clinical trials for native PrRP31 have been registered on ClinicalTrials.gov. Peripheral tissue expression of the peptide has been documented in human adrenal glands, lungs, pancreas, liver, kidneys, and reproductive organs, but no interventional studies have been reported.
  • Animal: GPR10 knockout mice develop late-onset hyperphagia and obesity, confirming the receptor's role in energy homeostasis (Pražienková and colleagues, 2019). In diet-induced obese (DIO) rodents, peripherally administered lipidized PrRP31 analogs reduced food intake, lowered body weight, improved glucose tolerance, and attenuated lipogenesis in two-week subcutaneous treatment studies (Kuneš and colleagues, 2016). The OLETF rat, a spontaneous obesity model, carries a loss-of-function mutation in GPR10, consistent with PrRP signaling protecting against hyperphagia. Brainstem PrRP has also been implicated in cancer-associated anorexia-cachexia syndrome in rats, where aberrant PrRP activation contributes to pathological appetite suppression.
  • In vitro: Langmead and colleagues (2000) characterized GPR10 binding using radioiodinated PrRP-20, demonstrating high-affinity binding (KD ~0.03 nM, high-affinity site) and calcium mobilization from intracellular stores as the primary signaling output. Palmitoylated PrRP31 analogs retain high GPR10 affinity (Ki ~3–5 nM) and gain substantially enhanced affinity at NPFF-R2 (Ki ~0.8 nM), enabling dual-receptor engagement not seen with the native peptide (Karnošová and colleagues, 2021).

Known effects

  • Appetite suppression (anorexigenic) — Preclinical: intracerebroventricular and peripheral administration reduces food intake in rodents; GPR10/PrRP knockout animals develop obesity
  • Body weight reduction — Preclinical only: lipidized analogs lower body weight in DIO and OLETF rat models; native PrRP31 has poor stability in plasma after peripheral administration
  • HPA axis activation / stress response — Preclinical: central PrRP31 elevates ACTH and corticosterone; PrRP neurons in NTS are key brainstem-to-hypothalamus stress relays
  • Prolactin release — In vitro / preclinical: stimulates pituitary prolactin secretion but at much higher concentrations than TRH, making this a minor physiological role
  • Mood and sleep modulation — Preclinical: PrRP inhibits MCH neurons; impaired PrRP signaling linked to stress-coping failure in rats (Vas and colleagues, 2023)
  • Glucose tolerance improvement — Preclinical: lipidized analogs improve metabolic parameters in obese rodent models (Kuneš and colleagues, 2016)

Safety signals

No human safety data exist for PrRP31. Rodent studies with repeated peripheral administration of lipidized PrRP31 analogs have not reported overt toxicity or adverse behavioral effects (Pražienková and colleagues, 2019). Because native PrRP31 activates HPA-axis stress circuitry and elevates corticosterone, off-target or supraphysiological central administration in animal models could in principle produce stress-like physiological responses; this has not been characterized formally.

Regulatory status

  • US/EU: Not approved, not an IND compound. Native PrRP31 is a research peptide used as a biochemical tool and pharmacological probe.
  • ClinicalTrials.gov: No registered trials found for PrRP31 or prolactin-releasing peptide (search as of June 2026).
  • WADA: Not listed on the WADA Prohibited List.

Mechanism

PrRP31 signals through GPR10, a class A GPCR. Langmead and colleagues (2000) showed that GPR10 coupling in HEK-293 cells does not involve cAMP modulation (neither Gs nor Gi), and that the primary downstream signal is calcium mobilization from intracellular stores — a response blocked by thapsigargin. Subsequent work identified additional coupling to Gi/Go proteins (pertussis toxin-sensitive) and activation of ERK, JNK, and PI3K-Akt-mTOR cascades (Pražienková and colleagues, 2019). PrRP31 also binds NPFF-R2 with lower affinity than GPR10; palmitoylated analogs gain substantially higher NPFF-R2 potency (Ki ~0.8 nM vs. low-affinity for native peptide), and combined GPR10/NPFF-R2 activation appears to be required for robust anti-obesity efficacy of lipidized analogs (Alexopoulou and colleagues, 2022). The RF-amide motif at the C-terminus (Arg-Phe-NH₂) is essential for high-affinity receptor engagement; truncation to shorter fragments progressively reduces potency. Note: the card sequence SRTHRHSMEIRTPDINPAWYASRGIRPVGRF represents the native 31-residue backbone — it does not carry the C-terminal amide modification present on endogenous PrRP31, which is required for full activity.

Open questions

  • No human pharmacokinetic or pharmacodynamic data for any PrRP31 analog; the step from rodent efficacy to human translation remains uncharted.
  • Selectivity of lipidized analogs between GPR10, NPFF-R2, and NPFF-R1 needs further profiling — Karnošová and colleagues (2021) showed palmitoylated forms also engage NPFF-R1 (Ki ~0.8 nM), whose involvement in anti-obesity effects is unclear.
  • The relative contributions of brainstem versus hypothalamic GPR10 circuits to appetite suppression versus stress-axis activation remain unresolved.
  • Whether PrRP31 plays a physiologically relevant role in human prolactin regulation in vivo remains an open question, given its low pituitary potency relative to TRH.
  • Oral or nasal delivery of stable PrRP31 analogs has not been reported.

Related peptides

  • Neuropeptide FF (NPFF) — RF-amide family member that shares the NPFF-R2 receptor targeted by PrRP31 and its lipidized analogs; involved in pain modulation and opioid modulation in the spinal cord.
  • GnRH / leuprolide — Gonadotropin-releasing hormone and its clinical analog leuprolide act on GnRHR, a distinct class A GPCR in the same hypothalamic-pituitary signaling network. PrRP and GnRH neurons both converge on the PVN but through separate receptor pathways.
  • TRH (thyrotropin-releasing hormone) — Hypothalamic tripeptide that is a more potent stimulator of pituitary prolactin release than PrRP, contextualizing PrRP's originally proposed prolactin-releasing function.
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.6644248366355896 boltz-2
ranking score 0.7042299509048462 boltz-2
▸structural qualityopenfold3
metricvaluenote
gpde1.091global PDE — lower = better
disorderNaNfraction disordered
▸3-letter notation
Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe
▸recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights—
hardwarenvidia_nim_api
mlx version—
python—
random seed—
msa strategynone
diffusion samples1
runtime—
predicted bymlx@peptide
predicted at2026-04-24
▸citationbibtex
peptidemodel (2026). Prolactin-releasing peptide: brain signal for appetite, stress & prolactin (PrRP31) (pep-10659, v1). PeptideModel. https://peptidemodel.com/card/pep-10659
@peptide{pep10659,
  sequence = {SRTHRHSMEIRTPDINPAWYASRGIRPVGRF},
  target   = {gnrhr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 1 by signal overlap
clinical trials 78 on ct.gov · checked 2026-05-09
ct.gov trials 78
with results 4
PubMed RCT 1
by phase
2phase 21phase 31phase 46no phase
by status
6completed1recruiting1not yet recruiting1terminated1unknown
references 1 papers
[1] evidence
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use