Neuromedin B-30: brain signaling peptide studied in pancreatic cancer
A natural brain and spinal-cord peptide involved in appetite, body temperature, and pain; reported at high levels in most pancreatic tumors; used as a lab research tool.
- Class
- Neuropeptide fragment (bombesin family)
- Status
- No approved therapeutic status identified
- Main caveat
- Single vendor/catalog source only. No bioactivity, receptor binding, animal, or human evidence is attached to this card.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
Neuromedin B-30 (NMB-30) is a 30-residue neuropeptide found in the mammalian brain and spinal cord. It belongs to the bombesin family — a group of peptides named after an amphibian skin peptide (bombesin) whose mammalian counterparts regulate appetite, hormone release, body temperature, and emotional responses. NMB-30 is the larger precursor form of Neuromedin B, the well-characterized 10-residue decapeptide: NMB-30 contains the entire NMB sequence at its C-terminus, extended by 20 additional residues at the N-terminus. Like NMB itself, it activates the neuromedin B receptor (NMBR, also called the BB1 receptor), a G protein-coupled receptor expressed throughout the brain and in peripheral tissues. The C-terminus of NMB-30 carries an amide group (–NH₂) that is essential for receptor binding but is not visible in the stored 1-letter sequence.
History
Neuromedin B, the 10-residue core peptide, was first identified from porcine spinal cord in 1983 by Minamino and colleagues, who noted its striking sequence similarity to the amphibian peptide bombesin and its potent smooth-muscle-stimulating activity. Two years later, the same group returned to porcine brain and spinal cord extracts and isolated two larger, N-terminally extended relatives: Neuromedin B-32 (32 residues) and Neuromedin B-30 (30 residues). Minamino and colleagues (1985) described NMB-30 as a two-amino-acid N-terminal deletion of NMB-32, with all three forms — NMB, NMB-30, and NMB-32 — constituting a biosynthetic family derived from a common precursor through sequential enzymatic processing. This isolation, reported in Biochemical and Biophysical Research Communications, established NMB-30 as a naturally occurring molecular form present in the mammalian central nervous system, not merely a synthetic fragment.
What it does
Neuromedin B-30 carries the full pharmacological activity of the NMB family at its C-terminal decapeptide end, which is the sequence that engages the NMBR/BB1 receptor. Through this receptor, NMB and its extended forms exert a range of effects documented across tissue and species studies. In the brain, NMB-family peptides act within the central amygdala to modulate fear and cardiovascular responses: injection into the central lateral amygdala excites neurons via BB1 receptors and alters fear-potentiated startle responses (Bhatt and colleagues 2023). In the pituitary, NMB functions as a paracrine/autocrine inhibitor of thyroid-stimulating hormone (TSH) secretion — pituitary thyrotroph cells produce their own NMB, and disruption of NMBR signaling impairs the ability of the thyrotroph to mount a TSH response during hypothyroidism (Kanasaki and colleagues 2006). NMB also influences appetite through peripheral satiety pathways that are distinct from those used by its cousin gastrin-releasing peptide (GRP). Additional roles documented in the literature include smooth muscle contraction in the gastrointestinal and urogenital tracts, regulation of blood pressure and body temperature, and stimulation of exocrine and endocrine secretions. In several cancer cell lines, NMB acts as an autocrine growth factor: it binds NMBR on small cell lung cancer cells, elevates intracellular calcium, and stimulates proliferation; NMBR also cross-activates the EGF receptor in non-small cell lung cancer cells.
Evidence
- Human: No clinical trials have evaluated Neuromedin B-30 directly. The broader NMB/NMBR system has been characterised in human tissues, and NMBR overexpression has been documented in human lung cancer cell lines and other tumors. No registered trials on ClinicalTrials.gov for "Neuromedin B-30."
- Animal: The 1985 isolation paper by Minamino and colleagues demonstrated that NMB-30 is an authentic mammalian neuropeptide present in porcine brain and spinal cord, sharing biosynthetic origin with NMB-32 and the decapeptide NMB. Rodent studies using NMB (which shares the active C-terminal pharmacophore with NMB-30) showed: NMBR-knockout mice display dysregulation of the pituitary-thyroid axis (Kanasaki and colleagues 2006); NMB injection into the central amygdala modulates cardiovascular output and fear-potentiated startle in rats (Bhatt and colleagues 2023).
- In vitro: NMB binds with high affinity to NMBR on small cell lung cancer cell lines, elevating cytosolic calcium in a concentration-dependent manner; these responses are blocked by NMBR-selective antagonists.
Known effects
- Fear and startle modulation — Preclinical (rat): BB1 receptor activation in the central lateral amygdala alters fear-potentiated startle and cardiovascular output
- TSH regulation — Preclinical (mouse): NMB/NMBR system modulates the pituitary-thyroid axis set point; NMBR-knockout mice show impaired TSH responses during hypothyroidism
- Smooth muscle contraction — Preclinical (rat uterus): original 1983 pharmacology of NMB family; active at bombesin receptors
- Appetite/satiety signaling — Preclinical: NMB mediates satiety via peripheral pathways distinct from those of GRP/BB2
- Tumor cell proliferation — In vitro: autocrine growth stimulation in small cell and non-small cell lung cancer cell lines via NMBR; also expressed in human pancreatic cancer cell lines
Mechanism
NMB-30 acts as an agonist at NMBR (BB1), a seven-transmembrane class A GPCR that shows more than 100-fold higher affinity for NMB-family peptides than for GRP-family peptides. The receptor couples to Gq/11, activating phospholipase C, generating IP₃ and diacylglycerol, mobilising intracellular calcium, and activating protein kinase C. In amygdala neurons, BB1 signalling additionally inhibits GIRK channels via a phospholipase Cβ–PKC pathway, increasing neuronal firing frequency (Bhatt and colleagues 2023). In lung cancer cells, NMBR transactivates the EGF receptor through BB1-initiated intracellular cascades, coupling bombesin-family signalling to mitogenic EGF pathway outputs. The pharmacophore driving receptor activation resides in the C-terminal heptapeptide — shared across NMB, NMB-30, and NMB-32 — explaining why the extended forms retain the same biological activity as the decapeptide.
Safety signals
No human safety data exist for Neuromedin B-30. It is a research peptide with no regulatory filings or published preclinical toxicology packages. All functional data derive from animal studies or cell-line experiments.
Regulatory status
- US (FDA): Not approved. No clinical use.
- EU (EMA): Not approved.
- WADA: Not listed on the Prohibited List.
- Research use: Synthetic NMB-30 is available from commercial peptide suppliers as a research-grade reagent.
Related peptides
- Neuromedin B (NMB) — the 10-residue C-terminal core peptide; the primary agonist at NMBR/BB1; NMB-30 and NMB-32 are its N-terminally extended precursor relatives
- Neuromedin B-32 — the 32-residue form isolated alongside NMB-30 by Minamino and colleagues (1985); NMB-30 is a two-amino-acid N-terminal deletion of NMB-32
- Gastrin-releasing peptide (GRP) — the other major mammalian bombesin-family peptide; activates the GRP receptor (GRPR/BB2) rather than BB1; the two systems share structural homology but distinct receptor selectivity and physiological roles
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Does NMB-30 actually engage the neurotensin receptor, or is that annotation a database error?
If the target label is wrong, researchers chasing an NMB-30/neurotensin-receptor drug lead are working on a false premise. Correcting it could save years of misdirected effort in pancreatic cancer programs.
Could we replace the useless N-terminal section of NMB-30 with a tumor-homing sequence to create a peptide that attacks cancer from two directions at once?
Dual-targeting peptides can kill cancer cells more efficiently than single-target agents, and this approach uses an existing natural scaffold rather than building from scratch, potentially shortening the path to a clinical candidate.
Does the longer precursor form of NMB activate the same downstream signals as the short processed form, or does the extra sequence change which signals fire?
If NMB-30 and NMB trigger different cellular programs, drugs that mimic or block one form could have more targeted effects, for example suppressing appetite without triggering the side effects tied to the other signaling arm.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.633167564868927 | openfold3-mlx |
| ranking score | 0.7961580753326416 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.709 | global PDE — lower = better |
| disorder | 0.302 | ! high disorder |
| chain pair ipTM (A, B) | 0.633 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | aedd8f3eb814e392… |
| hardware | apple_m4_base_16gb |
| mlx version | 0.31.1 |
| python | 3.14.3 |
| random seed | 42 |
| msa strategy | colabfold |
| diffusion samples | 1 |
| runtime | 355s |
| predicted by | mlx@peptide |
| predicted at | 2026-04-25 |
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1 ▸citationbibtex
@peptide{pep10621,
sequence = {LSWDLPEPRSRAGKIRVHPRGNLWATGHFM},
target = {ntsr1},
author = {peptidemodel},
year = {2026},
status = {synthesized}
}