pe
pep-10616 v1 CC-BY-SA-4.0

Gastrin-34: natural stomach-acid hormone (Big Gastrin)

A gut hormone made after meals that tells the stomach to produce acid and signals fullness to the brain; a natural body chemical, not a drug.

statussynthesized targetCCKAR length33 aa refs5
snapshot sparse 25% confidence
Class
Endogenous gastrointestinal peptide hormone
Status
No approved therapeutic status identified in source
Best-supported effect
Gastric acid secretion and parietal-cell stimulation via CCK2/gastrin receptor — endogenous physiological role only; no exogenous therapeutic evidence attached
Main caveat
This card describes an endogenous hormone with known physiology; no clinical, animal-model, or in vitro evidence for exogenous therapeutic use is attached to the source
status 4 / 5
prediction metrics boltz-2 1.0
ipTM0.605
pTM0.761
avg pLDDT71.7
ranking score0.695
STRUCTURE · PEP-10616 × CCKAR
ranking0.695
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence33 aa
15101520253033
LGPQGPPHLVA DPSKKQGPWLE EEEEAYGWMDF
overview readme

What this is

Gastrin-34 — also called Big Gastrin or G-34 — is a 34-amino-acid gut hormone and the larger of the two principal circulating forms of gastrin. It is produced in the G cells of the gastric antrum and duodenal mucosa as part of the body's normal machinery for regulating stomach acid after a meal. Despite being secreted in smaller quantities than its shorter sibling gastrin-17 (G-17), G-34 persists far longer in the bloodstream and accounts for most of the gastrin detectable in fasting serum. The sequence shown here represents the backbone of the mature peptide; the biologically active form carries a C-terminal amide cap (the conserved …Trp-Met-Asp-Phe-NH₂ pentapeptide shared by all active gastrins) and, in approximately half the natural molecules, a sulfated tyrosine residue — neither modification is visible in the stored single-letter sequence (Zeng and colleagues 2020; Boel and colleagues 1983).

History

The gastrin story begins at the University of Liverpool, where Hilda Tracy and Roderic Alfred Gregory isolated the hormone from human gastric antral mucosa in 1964, publishing the structures of two 17-residue peptides — gastrin I (unsulfated) and gastrin II (sulfated at tyrosine) — in a landmark set of three back-to-back Nature papers. They subsequently characterised a larger, less acidic set of peptides that were simply G-17 extended at their N-terminus by 17 additional residues; these were named "big gastrin" and are now universally called G-34. The molecular basis of gastrin's diversity was resolved in 1983 when Boel and colleagues cloned the human gastrin cDNA from a pancreatic gastrinoma, establishing that the preprogastrin precursor (101 amino acids) encodes both G-17 and G-34 as products of differential prohormone processing (Boel and colleagues 1983). Prohormone convertases PC1/3 and PC2 cleave progastrin at specific dibasic sites to generate G-34 and then G-17 sequentially, with C-terminal amidation added as the final activation step.

What it does

G-34's primary job is to stimulate gastric acid secretion — the same role as G-17, only with a slower onset and more sustained action due to its longer half-life. After a meal, the antrum releases predominantly G-17; during fasting, G-34 predominates in circulation because its plasma half-life (~15–40 minutes, compared to ~3–8 minutes for G-17) means it clears much more slowly (Zeng and colleagues 2020). Equimolar doses of G-34 and G-17 produce roughly comparable acid outputs, though G-17 is more potent on a per-unit-serum-concentration basis because far less of it is needed to achieve the same peak level.

Beyond acid secretion, gastrin-34 (like all amidated gastrins) exerts trophic, or growth-promoting, effects on the gastric mucosa — most prominently on the enterochromaffin-like (ECL) cells that sit alongside the acid-secreting parietal cells. Chronic elevation of gastrin drives ECL cell proliferation, and at sustained high levels can lead to ECL cell hyperplasia and, eventually, neoplastic change (Zeng and colleagues 2020).

Evidence

  • Human: G-34 is measured in clinical practice as part of serum gastrin assays used to diagnose hypersecretory disorders. Zollinger-Ellison syndrome — caused by gastrin-secreting pancreatic or duodenal tumors — involves dramatic elevations in circulating gastrin that include the G-34 fraction. Radiolabeled gastrin analogs targeting the CCK2 receptor (which G-34 activates) have been evaluated in clinical imaging studies of medullary thyroid carcinoma and other CCK2R-overexpressing tumors, with 111In-labeled minigastrin (MG0) visualising lesions in patients with occult medullary thyroid carcinoma (Roosenburg and colleagues 2011).
  • Animal: Early characterisation studies in dogs established G-34's acid-stimulating action and disappearance half-time. Gastrin receptor knockout mouse models have confirmed the CCK2R as the principal mediator of gastrin-driven acid secretion.
  • In vitro: CCK2R expressed on ECL and parietal cells mediates G-34's signalling through a Gq/PLC/Ca²⁺/PKC cascade. Trophic signalling through CCK2R activates the EGFR, PI3K, and ERK/MAPK pathways in ECL cell lines (Zeng and colleagues 2020; Berna and colleagues 2007).

Known effects

  • Gastric acid stimulation — Physiological; mediated via CCK2R on ECL cells (histamine release → H2R on parietal cells) and directly on parietal cells
  • ECL cell proliferation (trophic) — Established in animal models and inferred from human hypergastrinemia data; chronic hypergastrinemia → ECL hyperplasia
  • Sustained fasting acid tone — G-34's long half-life makes it the principal interdigestive gastrin in human serum
  • Calcitonin release from medullary thyroid carcinoma cells — CCK2R activation in MTC cells stimulates calcitonin secretion and calcitonin gene transcription; basis for radiopeptide imaging
  • Tumour receptor targeting — CCK2R overexpression in >90% of medullary thyroid carcinomas and 89% of small cell lung cancers has been exploited in radiolabelled gastrin analog imaging (Roosenburg and colleagues 2011)

Safety signals

Gastrin-34 is an endogenous human hormone; exogenous administration has been used experimentally but it is not an approved therapeutic. Pathological hypergastrinemia (as in Zollinger-Ellison syndrome) causes peptic ulceration, diarrhoea, and, over time, ECL cell hyperplasia. Long-term pharmacological suppression of gastric acid with proton-pump inhibitors raises endogenous gastrin levels (including G-34) as a reflexive compensatory response; the clinical significance of this chronic mild hypergastrinemia in terms of gastric neoplasia risk remains under investigation.

Regulatory status

  • US / EU: Not approved as a drug; used as a research reagent and as a reference standard in gastrin immunoassays.
  • WADA: Not listed as a prohibited substance.

Mechanism

CCK2R (also called the gastrin receptor or CCK-B receptor; gene CCKBR) is the principal receptor for G-34. It is a class A GPCR that couples through Gq protein to activate phospholipase Cβ, generating diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). IP3 drives cytosolic Ca²⁺ release; the combined Ca²⁺ and DAG signal activates protein kinase C, which together with downstream MAPK (ERK1/2) activation mediates both the acute secretory and the chronic trophic responses (Zeng and colleagues 2020; Miller and colleagues 2008).

The primary effector cell for acid secretion is the ECL cell: CCK2R stimulation triggers histamine exocytosis, and histamine then acts on H2 receptors on neighbouring parietal cells to activate adenylyl cyclase and drive H⁺/K⁺-ATPase-mediated proton secretion. G-34 can also activate CCK2R directly on parietal cells, providing a parallel, histamine-independent acid signal. Trophic signalling additionally recruits the EGFR transactivation pathway and PI3K/Akt axis, accounting for the proliferative effects on ECL cells (Zeng and colleagues 2020).

The stored sequence (LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF) represents the 34-residue backbone. The biologically active molecule carries a C-terminal amide (–Phe-NH₂) critical for receptor engagement, and approximately half of naturally occurring G-34 molecules are sulfated at the tyrosine residue near the C-terminus (Tyr on gastrin II variants); sulfation modestly enhances CCK2R binding affinity but is not required for activity (Berna and colleagues 2007). The card's target annotation lists the CCK-A receptor (cckar); the primary pharmacological target of gastrin-34 in published literature is the CCK-B/gastrin receptor (CCK2R / CCKBR), which has markedly higher affinity for gastrin than CCK-A (Miller and colleagues 2008).

Related peptides

  • Gastrin-17 — the more abundant postprandial form; shares the C-terminal sequence and CCK2R binding pharmacophore with G-34 but clears ~5× faster
  • Cholecystokinin (CCK) — the evolutionary sibling hormone; shares the C-terminal –Trp-Met-Asp-Phe-NH₂ motif and activates both CCK1R and CCK2R, with CCK1R preference distinguishing it from gastrin; see also related CCK receptor pharmacology literature (Berna and colleagues 2007; Miller and colleagues 2008)
  • Minigastrin (MG0/MG11) — synthetic truncated gastrin analogs developed for radiolabelled CCK2R imaging of medullary thyroid carcinoma and other neuroendocrine tumors (Roosenburg and colleagues 2011)
Hypotheses4 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Is gastrin-34 actually binding to its natural gastrin receptor rather than the cholecystokinin receptor it is annotated as targeting?

If the receptor annotation is wrong, clinical trials targeting CCK-AR with gastrin-34 as a reference compound would give misleading data. Correcting the target label protects the validity of research in stomach acid disorders and GI cancers.

The hypothesis
Gastrin-34's annotated target CCK-AR is likely incorrect as the primary receptor: the predominant physiological target of gastrin-34 in the GI tract and CNS is CCK-BR (CCK2R), and the moderate ipTM (0.605) with CCK-AR reflects genuine low affinity consistent with the known pharmacology, not a strong binding interaction.
Why it’s plausible
Gastrin-17 and gastrin-34 are selective CCK2R (CCK-BR) agonists; CCK itself, but not gastrin, is the physiological CCK1R (CCK-AR) ligand. The distinguishing feature is the sulfation status of tyrosine: sulfated gastrin has weak CCK1R activity, but non-sulfated gastrin (the majority form in circulation) is essentially CCK2R-selective. The README notes that approximately half of gastrin molecules are sulfated (at a position absent from the stored sequence), but even sulfated gastrin-34 has much lower CCK1R affinity than sulfated CCK. An ipTM of 0.605 is at the lower end of moderate confidence, consistent with off-target or weak binding rather than a cognate complex.
Why it matters
If CCK-AR is not the primary gastrin-34 receptor, drug programs targeting the CCK-AR/gastrin-34 axis in pancreatic disease would be misdirected, and therapeutic strategies should focus on CCK2R, which is well established as the gastrin receptor in gastric acid regulation and GI cancers.
Plausibility.92
Novelty.40
Impact.70
Basis · grounding1 paper · 2 computed/notes
[1]
noteREADME states C-terminal Trp-Met-Asp-Phe-NH2 pentapeptide is shared by all active gastrins; this motif is the CCK2R-binding pharmacophore common to gastrin and CCK
[2]
paper
CCK2R plays important role in peptic ulcer disease; gastrin is major hormonal mediator of gastric acid via CCK2R, not CCK1R
doi: 10.1016/j.coph.2007.09.011
[3]
structureboltz-2 ipTM=0.605 is the lowest in this batch, consistent with a non-cognate or low-affinity interaction with CCK-AR
openupdated 2026-06-05

Is gastrin-34 just a slow-release version of gastrin-17, gradually trimmed down by blood enzymes over hours?

If gastrin-34 is a natural depot form, it changes how doctors should interpret gastrin blood tests and could inspire engineered peptide drugs with built-in slow-release properties for sustained acid regulation or beta-cell therapies, without needing chemical modifications.

The hypothesis
The LGPQGPPHLVA N-terminal segment of gastrin-34 (residues 1-11) is an intrinsically disordered, proteolytically labile region that functions as a pharmacokinetic reservoir: sequential trimming by serum endopeptidases converts gastrin-34 through intermediates to gastrin-17, such that the EEEEEA-containing forms are substrates for glutamate-specific endopeptidases and the activity profile shifts from gastrin-34-type to gastrin-17-type over hours.
Why it’s plausible
Gastrin-34 contains the entire gastrin-17 sequence at its C-terminus; the N-terminal 17 residues (LGPQGPPHLVADPSKK) are the extension. LGPQGPP at positions 1-7 contains three prolines and glycines, motifs associated with high flexibility and collagenase/prolyl-endopeptidase susceptibility. The polyglutamate stretch EEEEEA at positions 23-28 could be a target for glutamate-specific carboxypeptidases or endopeptidases. If proteolytic conversion is sequential rather than abrupt, gastrin-34 would function as a slow-release precursor for gastrin-17, explaining its prolonged presence in fasting serum as a depot form rather than an independently regulated hormone.
Why it matters
If gastrin-34 is a pharmacokinetic depot for gastrin-17, then the two forms are not independent hormones but a single extended-release system, with implications for how gastrin secretion is measured and how gastrin-based therapeutics should be formulated.
Plausibility.55
Novelty.65
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceResidues 1-7 are LGPQGPP: three prolines and two glycines in seven residues, a classically flexible, protease-accessible motif; EEEEEA at positions 23-28 is a rare polyacidic run potentially targeted by specific endopeptidases
[2]
noteGastrin-34 persists far longer in bloodstream than gastrin-17 and accounts for most gastrin in fasting serum, suggesting slow conversion rather than independent regulation
[3]
paper
Gastrin gene cloning and processing established; biosynthetic precursor relationships between gastrin forms documented
doi: 10.1073/pnas.80.10.2866
openupdated 2026-06-05

Does the long chain of negatively charged amino acids in gastrin-34 help it find its target cells faster by sticking near positively charged cell surfaces?

If this pre-concentration mechanism is real, it explains why the larger gastrin-34 is more potent in the stomach than its shorter cousin despite similar receptor binding, and could inspire the design of longer-acting gastrin analogues for conditions requiring precise acid regulation.

The hypothesis
The polyglutamate stretch EEEEEA (residues 23-28) in gastrin-34 acts as an electrostatic antenna that concentrates the peptide near the positively charged extracellular face of CCK2R-expressing cells via non-specific electrostatic pre-association, increasing effective local concentration and accelerating receptor on-rate (kon) without contributing to equilibrium binding affinity.
Why it’s plausible
Gastrin-34 is unusual among gut hormones for its acidic polyglutamate stretch, which gives the peptide a highly negative net charge. Cell surfaces and extracellular matrix carry net positive charge in certain microenvironments (especially near mucus-covered gastric epithelium). Electrostatic pre-concentration of charged peptides near target cells is a documented mechanism for accelerating ligand-receptor association rates without changing Kd, analogous to how positively charged antimicrobial peptides concentrate near anionic membranes. The EEEEEA motif is conserved across species, suggesting functional significance beyond simple acidic padding.
Why it matters
If the polyglutamate stretch accelerates gastrin-34's on-rate at gastric epithelium, truncated gastrin analogues lacking this stretch would show lower apparent potency in cell-based assays at physiological peptide concentrations despite identical Kd, explaining why gastrin-17 and gastrin-34 differ in vivo despite similar CCK2R affinity.
Plausibility.50
Novelty.75
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceResidues 23-28 are EEEEEA: five consecutive glutamates followed by alanine, conferring a large negative charge unusual among gut hormones
[2]
noteGastrin-34 persists longer in bloodstream than gastrin-17, suggesting properties beyond simple receptor affinity govern its in vivo behavior; polyglutamate stretch is absent in gastrin-17 N-terminal extension
[3]
paper
Gastrin biology in colorectal cancer; gastrin forms with different N-terminal extensions have distinct physiological profiles
doi: 10.3389/fendo.2020.00112
openupdated 2026-06-05

Could gastrin-34's longer stay in the bloodstream make it more effective than gastrin-17 at driving the growth of insulin-producing pancreatic cells?

Restoring insulin-producing cells is a goal for both type 1 and advanced type 2 diabetes. A naturally longer-lasting gastrin form that stays in the blood longer might regenerate more beta cells per dose, improving on current experimental approaches that use the shorter form.

The hypothesis
Gastrin-34, via CCK2R agonism on pancreatic beta cells, could promote beta-cell mass expansion and improve insulin secretion in type 2 diabetes, and its longer half-life compared to gastrin-17 makes it a pharmacokinetically superior scaffold for beta-cell regeneration therapy.
Why it’s plausible
CCK2R is expressed on pancreatic beta cells, and gastrin/CCK2R signaling promotes beta-cell neogenesis and survival. The GLP-1/gastrin combination approach has been explored in clinical trials for type 1 diabetes restoration. Gastrin-34 circulates longer than gastrin-17 due to its larger size and the polyglutamate extension that may reduce renal clearance. A longer-acting CCK2R agonist with validated receptor engagement could serve as the gastrin component in combination regenerative therapies without requiring stabilizing modifications.
Why it matters
Beta-cell regeneration is the central unmet need in both type 1 and advanced type 2 diabetes. If gastrin-34's extended half-life makes it a more effective CCK2R agonist for beta-cell expansion than gastrin-17, it could become the preferred gastrin scaffold in combination islet-regeneration regimens.
Plausibility.55
Novelty.50
Impact.70
Basis · grounding2 papers · 1 computed/note
[1]
paper
CCK2R role in GI biology established; gastrin/CCK2R signaling in pancreatic islet biology is an extension of this receptor's tissue expression
doi: 10.1016/j.coph.2007.09.011
[2]
noteGastrin-34 accounts for most gastrin detectable in fasting serum and persists longer in bloodstream than gastrin-17, providing pharmacokinetic rationale for superior sustained CCK2R engagement
[3]
paper
Gastrin in colorectal carcinoma context; CCK2R expression on various cell types including pancreatic islet cells documented in related literature
doi: 10.3389/fendo.2020.00112
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.6045112609863281 boltz-2
ranking score 0.6949019432067871 boltz-2
structural qualityopenfold3
metricvaluenote
gpde1.376global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). Gastrin-34: natural stomach-acid hormone (Big Gastrin) (pep-10616, v1). PeptideModel. https://peptidemodel.com/card/pep-10616
@peptide{pep10616,
  sequence = {LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF},
  target   = {cckar},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 0 trials · checked 2026-05-09
0
no registered clinical trials as of 2026-05-09; we'll re-check periodically
references 5 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use