Enfuvirtide (Fuzeon): blocks HIV from entering cells

What this is

Enfuvirtide (brand name Fuzeon, also known as T-20) is an injectable antiretroviral medication for HIV-1 infection. It was the first drug in a class called fusion inhibitors — instead of attacking the virus after it has already entered a cell, enfuvirtide stops the virus at the cell surface, blocking it from getting in. It is a 36-amino-acid peptide derived from a stretch of HIV's own envelope protein (gp41), and it is used in combination with other anti-HIV drugs, typically in patients whose virus has become resistant to standard regimens (Matthews et al., Nat Rev Drug Discov 2004).

History

The lineage that became enfuvirtide began with peptide-fragment studies of HIV's envelope glycoprotein gp41 in the early 1990s. Wild, Matthews and colleagues at Duke University synthesized peptides matching predicted α-helical regions of gp41 and showed they were potent inhibitors of HIV replication in cell culture (Wild et al., PNAS 1992; Wild et al., PNAS 1994). One of those peptides — corresponding to the gp41 heptad-repeat-2 (HR2) region, originally called DP-178 — became the candidate drug T-20.

Trimeris, a Duke spinout, developed T-20 through clinical trials in partnership with Hoffmann-La Roche. The FDA granted accelerated approval to enfuvirtide on 13 March 2003 for use in combination antiretroviral therapy in treatment-experienced adults with ongoing HIV-1 replication — the first HIV drug approved that worked outside the virus's life cycle inside the cell (Matthews et al., Nat Rev Drug Discov 2004). The European Medicines Agency authorized it the same year. Jin and colleagues had separately described peptide inhibitors of gp41-mediated fusion in the parallel academic literature (Jin et al., AIDS Res Hum Retrovir 2000).

In August 2024, Genentech (Roche) announced it would end commercial distribution of Fuzeon in the United States effective 28 February 2025, citing reduced clinical need given better-tolerated oral and long-acting alternatives; the discontinuation was explicitly not for safety or efficacy reasons (Genentech statement, August 2024). Fuzeon was also discontinued in the UK in January 2025.

What it does

HIV-1 enters a target cell by fusing its outer envelope with the cell's outer membrane. That fusion is driven by a viral protein called gp41, which after engaging the CD4 receptor and a coreceptor on the cell surface folds in on itself like a closing jackknife — pulling the two membranes together until they merge. Enfuvirtide is a synthetic copy of part of gp41 itself; it binds to the unfolded form of gp41 on the virus and physically blocks it from completing the fold. The virus, unable to fuse, never delivers its genetic material into the cell (Matthews et al., Nat Rev Drug Discov 2004; Dwyer et al., PNAS 2007).

Because enfuvirtide blocks entry rather than replication, it works against HIV-1 strains that have become resistant to reverse-transcriptase inhibitors, protease inhibitors, or integrase inhibitors. Its mechanism is also why it has to be given by subcutaneous injection twice daily — as a 36-residue peptide, it cannot survive oral digestion, and it is rapidly cleared from circulation by peptidase breakdown to its constituent amino acids (LiverTox, NIH 2018; Chong et al., J Virol 2018).

Mechanism

The HIV-1 envelope spike is a trimer of gp120/gp41 heterodimers. When gp120 engages CD4 and a coreceptor (CCR5 or CXCR4), gp41 is exposed and inserts a hydrophobic fusion peptide into the target membrane. Gp41 then refolds: its two heptad-repeat regions — HR1 (N-terminal) and HR2 (C-terminal) — pack against each other to form a thermodynamically stable six-helix bundle, with three HR1 helices forming a central coiled coil and three HR2 helices folding back antiparallel into the grooves on its surface. That bundle formation is what physically draws the viral and cellular membranes together (Dwyer et al., PNAS 2007; Chong et al., J Virol 2018).

The stored sequence YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF is the linear 36-amino-acid HR2-derived backbone with no non-standard residues; the active drug is this unmodified peptide administered subcutaneously. Enfuvirtide binds the exposed HR1 trimeric coiled coil during the fusion-intermediate state and competes with the virus's own HR2 for that groove. With enfuvirtide bound, the native HR2 cannot pack in, the six-helix bundle never forms, and fusion is blocked (Dwyer et al., PNAS 2007; Jin et al., AIDS Res Hum Retrovir 2000).

Resistance to enfuvirtide arises from mutations in the HR1 region of gp41 that reduce the peptide's binding affinity, clustered around the N-terminal portion of HR1. These resistance mutations have driven design of second- and third-generation fusion inhibitors with extended HR2 sequences, lipid conjugation, or hyperstable bundles intended to retain activity against enfuvirtide-resistant virus (Dwyer et al., PNAS 2007; Chong et al., J Virol 2018; Zhu et al., J Virol 2019).

Evidence

• Human: Two pivotal Phase III randomized open-label trials, TORO-1 (North America and Brazil) and TORO-2 (Europe and Australia), together enrolled nearly 1,000 heavily treatment-experienced HIV-1 patients in 2001–2002. In TORO-1, adding enfuvirtide to an individually optimized background regimen produced roughly twice the rate of virologic response (HIV-1 RNA reduction) at 24 weeks compared with the background regimen alone (Lalezari et al., NEJM 2003). The companion TORO-2 trial reported a consistent effect in the European/Australian cohort. These trials supported FDA accelerated approval. Long-term clinical experience confirmed durable benefit when enfuvirtide is part of a regimen containing at least one other fully active drug (Matthews et al., Nat Rev Drug Discov 2004).
• In vitro: Enfuvirtide blocks HIV-1 entry at nanomolar concentrations in cell-culture fusion and infectivity assays; potency drops sharply against gp41 mutants carrying resistance substitutions, motivating successor designs (Dwyer et al., PNAS 2007; Chong et al., J Virol 2018; Zhu et al., J Virol 2019).
• Structural: Enfuvirtide is itself derived from the HR2 region of gp41, and its mechanism was rationalized by gp41 core-structure work referenced extensively across the fusion-inhibitor literature (Dwyer et al., PNAS 2007).

Known effects

• HIV-1 viral suppression (combination therapy) — FDA-approved, validated in TORO-1 / TORO-2 (Lalezari et al., NEJM 2003).
• Activity against multidrug-resistant HIV-1 — Established in salvage regimens with at least one other active drug (Matthews et al., Nat Rev Drug Discov 2004).
• No activity against HIV-2 — Enfuvirtide is HIV-1-specific; the HR1 sequence it targets differs in HIV-2 (successor inhibitors have been designed to broaden coverage to HIV-2 and SIV — Chong et al., J Virol 2018).

Safety signals

Documented from clinical-trial and post-marketing data (FDA Fuzeon label; LiverTox, NIH 2018):

• Injection-site reactions occurred in approximately 98% of patients in pivotal trials — pain, induration, erythema, nodules, cysts, pruritus, and ecchymosis. Reactions typically resolved in 3–7 days but lasted longer than a week in roughly a quarter of patients. Injection-site reactions were the most common reason for treatment discontinuation in clinical use.
• Hypersensitivity reactions occurred in fewer than 1% of patients but could include rash, fever, nausea, chills, hypotension, and elevated liver transaminases; per the FDA label, rechallenge after a clear hypersensitivity event is contraindicated.
• Bacterial pneumonia — An increased rate of bacterial pneumonia was observed in TORO trial participants receiving enfuvirtide compared with controls; causality is debated and may partly reflect the heavily treatment-experienced trial population (Matthews et al., Nat Rev Drug Discov 2004; FDA label).
• Hepatotoxicity — Enfuvirtide undergoes minimal hepatic metabolism (the peptide is catabolized to its constituent amino acids) and does not interact with CYP450 enzymes. LiverTox assigns enfuvirtide a "likelihood E" rating (unlikely cause of clinically apparent liver injury); transaminase elevations seen in hypersensitivity events are an exception (LiverTox, NIH 2018).

Regulatory status

• US: FDA-approved 13 March 2003 (accelerated approval) for HIV-1 infection in combination with other antiretrovirals in treatment-experienced patients. Genentech discontinued commercial distribution of Fuzeon in the United States effective 28 February 2025; the discontinuation was not for safety or efficacy reasons but reflected reduced clinical need given newer regimens (Genentech statement, August 2024).
• EU: EMA-approved 2003 (Fuzeon). Discontinued in the UK in January 2025.
• WADA: Not on the WADA Prohibited List. Enfuvirtide is an antiviral entry inhibitor, not a peptide hormone, growth factor, or related substance.

Related peptides

Enfuvirtide is the parent of an extended family of gp41-derived peptide fusion inhibitors. Successor designs explored in the literature include:

• C34 — A longer HR2-derived peptide overlapping the enfuvirtide sequence; used as a research benchmark for HR1-binding fusion inhibitors (Chong et al., J Virol 2018).
• T-1249 — A second-generation peptide combining sequences from gp41 of HIV-1, HIV-2 and SIV; designed for higher potency and to overcome T-20 resistance, with clinical development halted at Phase II.
• Lipopeptide and cholesterylated fusion inhibitors (LP-40, LP-52, C34-Chol) — T-20-derivative peptides conjugated to fatty acids or cholesterol to anchor in the membrane and achieve potency and durability that enfuvirtide lacks (Chong et al., J Virol 2018; Zhu et al., J Virol 2019).

These successors have not reached clinical approval; enfuvirtide remains the only fusion inhibitor that ever did.

Open questions

• No oral formulation has been validated; subcutaneous injection is the only established route.
• The genetic barrier to resistance is relatively low compared with other antiretroviral classes; the molecular determinants of durable suppression in long-term combination regimens are incompletely characterized.
• Next-generation lipopeptide and cholesterylated fusion inhibitors show superior in vitro potency against enfuvirtide-resistant variants (Chong et al., J Virol 2018; Zhu et al., J Virol 2019), but head-to-head clinical comparisons have not been published.
• Broader antiviral activity against HIV-2 and SIV — demonstrated in vitro for some derivatives — has not been established for enfuvirtide itself in clinical settings.